Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167F8P9

Protein Details
Accession A0A167F8P9   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
193-222DEEDAKPARKKSKKGQGKAKKARKYVHGISBasic
NLS Segment(s)
PositionSequence
198-216KPARKKSKKGQGKAKKARK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.333, mito_nucl 9.166, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR036322  WD40_repeat_dom_sf  
KEGG slb:AWJ20_2583  -  
Amino Acid Sequences MITSIVDMSFKNSYHFITTGSYTLVHLDIRKGVLSTSEEQSDEFLSGCITSDRYSVFGMSEGTVTVWDNSHLDEIQKSGMTLSDQSIDCVIAGAEENEVFAGGADGLVYKLNVHSSKKESIWTHSKKEEVSMLELDSEYRLVTAGMETVKIWRSPADQRQLEEAEEAEQAATSAEKDIENSNDSESQKKNDSDEEDAKPARKKSKKGQGKAKKARKYVHGISSFEGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.21
4 0.21
5 0.22
6 0.21
7 0.2
8 0.19
9 0.15
10 0.16
11 0.15
12 0.14
13 0.13
14 0.14
15 0.15
16 0.16
17 0.16
18 0.15
19 0.14
20 0.15
21 0.18
22 0.2
23 0.21
24 0.21
25 0.21
26 0.21
27 0.22
28 0.19
29 0.16
30 0.12
31 0.09
32 0.07
33 0.07
34 0.08
35 0.07
36 0.08
37 0.08
38 0.09
39 0.09
40 0.11
41 0.11
42 0.11
43 0.11
44 0.1
45 0.1
46 0.1
47 0.09
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.08
57 0.09
58 0.09
59 0.09
60 0.09
61 0.1
62 0.1
63 0.1
64 0.09
65 0.07
66 0.08
67 0.08
68 0.08
69 0.08
70 0.11
71 0.11
72 0.12
73 0.12
74 0.11
75 0.1
76 0.09
77 0.08
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.03
85 0.04
86 0.03
87 0.03
88 0.03
89 0.02
90 0.02
91 0.02
92 0.02
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.06
99 0.09
100 0.1
101 0.13
102 0.17
103 0.2
104 0.21
105 0.26
106 0.24
107 0.28
108 0.37
109 0.38
110 0.39
111 0.39
112 0.4
113 0.35
114 0.35
115 0.33
116 0.24
117 0.22
118 0.18
119 0.16
120 0.15
121 0.14
122 0.13
123 0.09
124 0.08
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.06
134 0.06
135 0.08
136 0.09
137 0.1
138 0.1
139 0.1
140 0.13
141 0.21
142 0.28
143 0.36
144 0.37
145 0.38
146 0.42
147 0.42
148 0.39
149 0.32
150 0.25
151 0.17
152 0.14
153 0.13
154 0.08
155 0.07
156 0.06
157 0.06
158 0.05
159 0.04
160 0.05
161 0.06
162 0.06
163 0.08
164 0.1
165 0.12
166 0.14
167 0.15
168 0.17
169 0.21
170 0.22
171 0.27
172 0.27
173 0.29
174 0.33
175 0.34
176 0.34
177 0.34
178 0.38
179 0.4
180 0.44
181 0.43
182 0.44
183 0.45
184 0.47
185 0.47
186 0.49
187 0.52
188 0.54
189 0.58
190 0.62
191 0.71
192 0.77
193 0.81
194 0.86
195 0.87
196 0.9
197 0.93
198 0.93
199 0.91
200 0.89
201 0.86
202 0.83
203 0.82
204 0.78
205 0.77
206 0.74
207 0.66