Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167F4Y6

Protein Details
Accession A0A167F4Y6   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
177-196GSVAKKTPKKTLYKKGPVLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013268  U3_snoRNA_assoc  
Gene Ontology GO:0030515  F:snoRNA binding  
GO:0006364  P:rRNA processing  
KEGG slb:AWJ20_2447  -  
Pfam View protein in Pfam  
PF08297  U3_snoRNA_assoc  
Amino Acid Sequences MAVLRQPPRTPVRRVASGASATNGLGTPSAKHRTFNDDDDFELGASKTNENEEDLEQPDDGTSNDKNNSEAEEDSDSDEAPEEESNSSAAQQLRQRTIERERLQAEEVAREKARRRERDLWLKQQKEKALSSLLPDSVFEELEEEQAKKETSSSSNTITSNNSILNPKKPQHIKLDGSVAKKTPKKTLYKKGPVLVKVLGQAKKLAPQRENVVSQTRDSFLNRKSIHRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.59
3 0.55
4 0.52
5 0.46
6 0.38
7 0.31
8 0.24
9 0.22
10 0.18
11 0.13
12 0.1
13 0.1
14 0.11
15 0.17
16 0.25
17 0.25
18 0.28
19 0.3
20 0.37
21 0.42
22 0.45
23 0.45
24 0.38
25 0.38
26 0.38
27 0.35
28 0.27
29 0.23
30 0.17
31 0.14
32 0.14
33 0.13
34 0.12
35 0.14
36 0.14
37 0.15
38 0.17
39 0.15
40 0.17
41 0.18
42 0.18
43 0.16
44 0.15
45 0.14
46 0.12
47 0.11
48 0.11
49 0.1
50 0.13
51 0.16
52 0.16
53 0.17
54 0.17
55 0.19
56 0.18
57 0.17
58 0.16
59 0.15
60 0.16
61 0.16
62 0.16
63 0.13
64 0.11
65 0.11
66 0.09
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.1
76 0.1
77 0.13
78 0.16
79 0.2
80 0.22
81 0.25
82 0.26
83 0.28
84 0.33
85 0.39
86 0.38
87 0.39
88 0.38
89 0.37
90 0.36
91 0.34
92 0.28
93 0.23
94 0.22
95 0.2
96 0.19
97 0.2
98 0.22
99 0.29
100 0.37
101 0.37
102 0.44
103 0.5
104 0.58
105 0.67
106 0.7
107 0.72
108 0.73
109 0.72
110 0.68
111 0.65
112 0.59
113 0.52
114 0.46
115 0.37
116 0.31
117 0.26
118 0.25
119 0.22
120 0.19
121 0.15
122 0.15
123 0.14
124 0.11
125 0.11
126 0.08
127 0.07
128 0.07
129 0.08
130 0.1
131 0.09
132 0.09
133 0.1
134 0.11
135 0.09
136 0.1
137 0.11
138 0.12
139 0.17
140 0.19
141 0.21
142 0.24
143 0.25
144 0.25
145 0.25
146 0.24
147 0.2
148 0.19
149 0.17
150 0.2
151 0.22
152 0.27
153 0.32
154 0.33
155 0.4
156 0.45
157 0.48
158 0.52
159 0.57
160 0.54
161 0.51
162 0.58
163 0.54
164 0.52
165 0.5
166 0.44
167 0.43
168 0.45
169 0.44
170 0.44
171 0.47
172 0.54
173 0.61
174 0.7
175 0.73
176 0.78
177 0.82
178 0.79
179 0.79
180 0.7
181 0.65
182 0.56
183 0.46
184 0.42
185 0.43
186 0.39
187 0.33
188 0.34
189 0.31
190 0.37
191 0.41
192 0.43
193 0.38
194 0.4
195 0.46
196 0.49
197 0.52
198 0.48
199 0.49
200 0.44
201 0.44
202 0.42
203 0.37
204 0.33
205 0.34
206 0.37
207 0.32
208 0.41
209 0.4