Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FEC0

Protein Details
Accession A0A0C4FEC0   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
120-139VEPRRPPSKRGQSRIDCAAPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 7, extr 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009286  Ins_P5_2-kin  
IPR043001  IP5_2-K_N_lobe  
Gene Ontology GO:0005524  F:ATP binding  
GO:0035299  F:inositol pentakisphosphate 2-kinase activity  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF06090  Ins_P5_2-kin  
Amino Acid Sequences MVNSSTQHPANLPLSQAVAATQPTHWTYIAEGAANLILAYRPAPGSPAEESLRGKCLRLAKRIQAHPPAIATDQHPTQVSFFDFHHHILRALLPQEQLLRFDLVTLAVPQPWLDQLAAAVEPRRPPSKRGQSRIDCAAPLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.13
5 0.12
6 0.11
7 0.11
8 0.1
9 0.13
10 0.14
11 0.16
12 0.15
13 0.14
14 0.14
15 0.17
16 0.18
17 0.14
18 0.13
19 0.11
20 0.11
21 0.1
22 0.09
23 0.05
24 0.04
25 0.04
26 0.04
27 0.05
28 0.05
29 0.05
30 0.07
31 0.07
32 0.1
33 0.11
34 0.15
35 0.16
36 0.18
37 0.2
38 0.2
39 0.24
40 0.22
41 0.2
42 0.2
43 0.27
44 0.3
45 0.35
46 0.38
47 0.4
48 0.48
49 0.52
50 0.54
51 0.52
52 0.48
53 0.42
54 0.38
55 0.32
56 0.25
57 0.21
58 0.16
59 0.13
60 0.12
61 0.13
62 0.13
63 0.12
64 0.11
65 0.11
66 0.11
67 0.1
68 0.1
69 0.12
70 0.13
71 0.14
72 0.17
73 0.16
74 0.15
75 0.15
76 0.16
77 0.15
78 0.15
79 0.15
80 0.12
81 0.13
82 0.15
83 0.15
84 0.16
85 0.15
86 0.15
87 0.13
88 0.13
89 0.12
90 0.09
91 0.09
92 0.1
93 0.09
94 0.08
95 0.08
96 0.08
97 0.09
98 0.09
99 0.1
100 0.08
101 0.07
102 0.07
103 0.09
104 0.09
105 0.1
106 0.11
107 0.12
108 0.16
109 0.2
110 0.28
111 0.29
112 0.32
113 0.43
114 0.53
115 0.6
116 0.65
117 0.71
118 0.72
119 0.77
120 0.8
121 0.72