Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A161HKY9

Protein Details
Accession A0A161HKY9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
231-253LADRLDLPRTKDRRNRRKAADLFHydrophilic
NLS Segment(s)
PositionSequence
170-174PAKRG
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
KEGG slb:AWJ20_4784  -  
Amino Acid Sequences MSVNMVFDAETLADGCLDALTSEAVYYEGTSIKPTEIRPAKPYPFKEGVTLTVRQAFESDRKIKGARARSRYYLFNGEPTRAEDELRFGLDDYFEQAGKGPNSSSNRGYRDDRRSRYRDRDGRRGRDRDQDDDGDLFPLKAGEFRESIRGSDLRGRDSGSDRDRNYDRRPAKRGKSYRYLDRNRSRSPGRDSADEPTPSNDSRSRNLSDRLDTPWVKGDLLEKIDNGRDELADRLDLPRTKDRRNRRKAADLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.06
12 0.06
13 0.06
14 0.07
15 0.08
16 0.08
17 0.1
18 0.11
19 0.12
20 0.15
21 0.16
22 0.25
23 0.31
24 0.34
25 0.39
26 0.46
27 0.52
28 0.58
29 0.6
30 0.58
31 0.57
32 0.54
33 0.52
34 0.45
35 0.43
36 0.38
37 0.37
38 0.3
39 0.31
40 0.3
41 0.26
42 0.25
43 0.23
44 0.23
45 0.3
46 0.32
47 0.28
48 0.31
49 0.32
50 0.35
51 0.4
52 0.45
53 0.46
54 0.5
55 0.53
56 0.56
57 0.58
58 0.57
59 0.54
60 0.51
61 0.42
62 0.43
63 0.39
64 0.35
65 0.33
66 0.32
67 0.31
68 0.24
69 0.24
70 0.16
71 0.18
72 0.17
73 0.17
74 0.14
75 0.11
76 0.1
77 0.1
78 0.1
79 0.09
80 0.09
81 0.09
82 0.08
83 0.09
84 0.12
85 0.12
86 0.13
87 0.1
88 0.15
89 0.19
90 0.23
91 0.26
92 0.28
93 0.31
94 0.34
95 0.39
96 0.41
97 0.47
98 0.54
99 0.56
100 0.59
101 0.62
102 0.66
103 0.7
104 0.72
105 0.71
106 0.69
107 0.73
108 0.73
109 0.77
110 0.78
111 0.75
112 0.68
113 0.69
114 0.65
115 0.58
116 0.52
117 0.44
118 0.36
119 0.31
120 0.28
121 0.2
122 0.16
123 0.12
124 0.08
125 0.07
126 0.06
127 0.07
128 0.08
129 0.08
130 0.09
131 0.1
132 0.16
133 0.16
134 0.17
135 0.18
136 0.17
137 0.17
138 0.22
139 0.22
140 0.19
141 0.19
142 0.19
143 0.19
144 0.22
145 0.27
146 0.28
147 0.33
148 0.32
149 0.37
150 0.4
151 0.44
152 0.45
153 0.48
154 0.5
155 0.51
156 0.58
157 0.62
158 0.66
159 0.71
160 0.75
161 0.73
162 0.75
163 0.73
164 0.76
165 0.77
166 0.77
167 0.77
168 0.78
169 0.78
170 0.72
171 0.73
172 0.68
173 0.65
174 0.64
175 0.62
176 0.56
177 0.53
178 0.51
179 0.48
180 0.5
181 0.45
182 0.38
183 0.32
184 0.32
185 0.28
186 0.3
187 0.31
188 0.28
189 0.31
190 0.35
191 0.36
192 0.38
193 0.43
194 0.44
195 0.43
196 0.42
197 0.42
198 0.45
199 0.41
200 0.38
201 0.38
202 0.35
203 0.31
204 0.29
205 0.27
206 0.25
207 0.29
208 0.28
209 0.22
210 0.24
211 0.28
212 0.27
213 0.26
214 0.21
215 0.17
216 0.17
217 0.19
218 0.18
219 0.15
220 0.15
221 0.16
222 0.22
223 0.24
224 0.29
225 0.37
226 0.41
227 0.5
228 0.59
229 0.68
230 0.73
231 0.81
232 0.85
233 0.84