Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4F931

Protein Details
Accession A0A0C4F931   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-24QLMQGYRERKDRERRTIQDRYAIHydrophilic
NLS Segment(s)
PositionSequence
240-256PHHASKKPPPPASRSRK
Subcellular Location(s) cyto 10.5, cyto_mito 10, mito 8.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:1990508  C:CKM complex  
GO:0016592  C:mediator complex  
GO:0005524  F:ATP binding  
GO:0004693  F:cyclin-dependent protein serine/threonine kinase activity  
GO:0008353  F:RNA polymerase II CTD heptapeptide repeat kinase activity  
GO:0060258  P:negative regulation of filamentous growth  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0070481  P:nuclear-transcribed mRNA catabolic process, non-stop decay  
GO:0000435  P:positive regulation of transcription from RNA polymerase II promoter by galactose  
GO:0031648  P:protein destabilization  
GO:0006468  P:protein phosphorylation  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
Amino Acid Sequences MQLMQGYRERKDRERRTIQDRYAILGFISSGTYGKVYKARPRDAPGAAVAIKKFKPDRDGEASYTGISQSACREIMLNREIGHENLTALQEVMLQDKAIYLVFEYCEHDFLQIIHHHSQTRSAIPEPTLKALLFQLLNGLAYLHANWIVHRDLKPANILVTERGVVKIGDLGLARSFHSPIQSLYASDKVVVTIWYRAPELLLGARHYSPAIDVWSVGCILGELLCLRPIFKGDEAKPEPHHASKKPPPPASRSRKTSSPRSSTSSERPPVEPLSLTTYRHRRDTDAVGRVEEEEWPSIVHLPEYAHMARFDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.82
4 0.86
5 0.81
6 0.78
7 0.69
8 0.63
9 0.53
10 0.45
11 0.35
12 0.25
13 0.21
14 0.13
15 0.12
16 0.08
17 0.07
18 0.07
19 0.09
20 0.09
21 0.12
22 0.18
23 0.23
24 0.31
25 0.39
26 0.45
27 0.5
28 0.56
29 0.6
30 0.56
31 0.53
32 0.46
33 0.42
34 0.37
35 0.34
36 0.28
37 0.27
38 0.26
39 0.29
40 0.31
41 0.31
42 0.35
43 0.36
44 0.43
45 0.46
46 0.5
47 0.46
48 0.46
49 0.43
50 0.36
51 0.32
52 0.25
53 0.17
54 0.13
55 0.11
56 0.1
57 0.12
58 0.12
59 0.12
60 0.14
61 0.13
62 0.2
63 0.21
64 0.2
65 0.18
66 0.21
67 0.22
68 0.21
69 0.22
70 0.16
71 0.14
72 0.15
73 0.15
74 0.11
75 0.1
76 0.09
77 0.09
78 0.09
79 0.1
80 0.08
81 0.08
82 0.07
83 0.07
84 0.08
85 0.06
86 0.06
87 0.05
88 0.06
89 0.07
90 0.08
91 0.1
92 0.1
93 0.11
94 0.12
95 0.11
96 0.11
97 0.1
98 0.13
99 0.14
100 0.17
101 0.18
102 0.2
103 0.22
104 0.21
105 0.26
106 0.23
107 0.23
108 0.21
109 0.2
110 0.2
111 0.2
112 0.25
113 0.22
114 0.21
115 0.21
116 0.18
117 0.17
118 0.16
119 0.17
120 0.11
121 0.1
122 0.09
123 0.08
124 0.08
125 0.07
126 0.07
127 0.04
128 0.05
129 0.05
130 0.04
131 0.05
132 0.05
133 0.05
134 0.07
135 0.08
136 0.11
137 0.11
138 0.14
139 0.14
140 0.15
141 0.17
142 0.15
143 0.14
144 0.12
145 0.12
146 0.1
147 0.09
148 0.09
149 0.08
150 0.08
151 0.08
152 0.07
153 0.07
154 0.07
155 0.06
156 0.07
157 0.07
158 0.07
159 0.07
160 0.08
161 0.09
162 0.09
163 0.1
164 0.09
165 0.1
166 0.1
167 0.1
168 0.13
169 0.12
170 0.12
171 0.13
172 0.15
173 0.14
174 0.13
175 0.13
176 0.09
177 0.09
178 0.1
179 0.09
180 0.1
181 0.11
182 0.12
183 0.12
184 0.12
185 0.12
186 0.11
187 0.11
188 0.1
189 0.1
190 0.1
191 0.12
192 0.12
193 0.12
194 0.12
195 0.11
196 0.09
197 0.09
198 0.1
199 0.08
200 0.08
201 0.08
202 0.08
203 0.08
204 0.08
205 0.06
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.05
212 0.07
213 0.07
214 0.08
215 0.08
216 0.1
217 0.12
218 0.15
219 0.23
220 0.22
221 0.33
222 0.36
223 0.4
224 0.41
225 0.44
226 0.45
227 0.44
228 0.49
229 0.43
230 0.49
231 0.54
232 0.61
233 0.65
234 0.68
235 0.66
236 0.67
237 0.74
238 0.75
239 0.75
240 0.74
241 0.7
242 0.71
243 0.73
244 0.75
245 0.74
246 0.72
247 0.67
248 0.66
249 0.65
250 0.63
251 0.64
252 0.64
253 0.6
254 0.55
255 0.52
256 0.5
257 0.49
258 0.44
259 0.37
260 0.29
261 0.31
262 0.31
263 0.32
264 0.36
265 0.43
266 0.44
267 0.5
268 0.5
269 0.47
270 0.49
271 0.57
272 0.57
273 0.56
274 0.53
275 0.48
276 0.47
277 0.43
278 0.38
279 0.3
280 0.23
281 0.17
282 0.16
283 0.15
284 0.15
285 0.16
286 0.16
287 0.14
288 0.14
289 0.14
290 0.15
291 0.2
292 0.2
293 0.2