Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167EQD3

Protein Details
Accession A0A167EQD3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-41AMSGGKSKKKKWSKGKVKDKAQHHVIBasic
NLS Segment(s)
PositionSequence
12-35KAAAAMSGGKSKKKKWSKGKVKDK
Subcellular Location(s) mito 13.5, cyto 10, mito_nucl 9.166, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG slb:AWJ20_5312  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKIQQSKAAKAAAAMSGGKSKKKKWSKGKVKDKAQHHVILDQPLYDRIFKEAATYKLVTVSVLVDRLKIGGSLARRALKDLEAQGVIKPVIGHSKQYTYTKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.28
3 0.2
4 0.14
5 0.19
6 0.21
7 0.27
8 0.3
9 0.34
10 0.42
11 0.52
12 0.61
13 0.65
14 0.75
15 0.79
16 0.86
17 0.92
18 0.92
19 0.92
20 0.89
21 0.85
22 0.82
23 0.75
24 0.68
25 0.58
26 0.51
27 0.43
28 0.38
29 0.32
30 0.24
31 0.19
32 0.17
33 0.17
34 0.14
35 0.12
36 0.1
37 0.11
38 0.1
39 0.13
40 0.15
41 0.16
42 0.18
43 0.18
44 0.16
45 0.17
46 0.17
47 0.14
48 0.1
49 0.1
50 0.07
51 0.09
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.08
60 0.1
61 0.13
62 0.18
63 0.21
64 0.21
65 0.23
66 0.24
67 0.23
68 0.25
69 0.24
70 0.23
71 0.2
72 0.21
73 0.2
74 0.21
75 0.19
76 0.16
77 0.14
78 0.12
79 0.19
80 0.2
81 0.24
82 0.25
83 0.3
84 0.35
85 0.39