Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167C2S5

Protein Details
Accession A0A167C2S5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-78IFQDRIRRRKPPWKKEDMECESHydrophilic
NLS Segment(s)
PositionSequence
63-71RRRKPPWKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
KEGG slb:AWJ20_3949  -  
Amino Acid Sequences MPLEQRYDTLQDNYIVRLHRNVDPENPVNAESTWWRKHMEHNELVQRLYEVLPKEEIFQDRIRRRKPPWKKEDMECESKAWKVKSELKKKIYQRHHTIWETQYRTSAKGEFYRSYTLPRLYNADHKNPLRYFLNECSKNELSKLVQLRTAKGAFGMFFKRFKINNRPHQCECGEEEDVKHLLCECPVTENHRQILRDASAMLDLKVLLDSKKGLKAVLAFLAKAPQLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.25
4 0.27
5 0.28
6 0.29
7 0.34
8 0.35
9 0.36
10 0.42
11 0.43
12 0.42
13 0.4
14 0.36
15 0.31
16 0.28
17 0.25
18 0.23
19 0.28
20 0.28
21 0.28
22 0.31
23 0.31
24 0.4
25 0.48
26 0.51
27 0.49
28 0.53
29 0.6
30 0.58
31 0.57
32 0.47
33 0.38
34 0.31
35 0.25
36 0.22
37 0.15
38 0.15
39 0.17
40 0.17
41 0.19
42 0.21
43 0.22
44 0.22
45 0.26
46 0.34
47 0.39
48 0.48
49 0.5
50 0.54
51 0.61
52 0.68
53 0.74
54 0.76
55 0.78
56 0.79
57 0.8
58 0.8
59 0.82
60 0.78
61 0.74
62 0.64
63 0.56
64 0.48
65 0.44
66 0.42
67 0.32
68 0.28
69 0.27
70 0.35
71 0.43
72 0.52
73 0.59
74 0.59
75 0.66
76 0.71
77 0.75
78 0.75
79 0.74
80 0.72
81 0.69
82 0.71
83 0.65
84 0.62
85 0.57
86 0.55
87 0.49
88 0.41
89 0.39
90 0.32
91 0.32
92 0.29
93 0.26
94 0.2
95 0.22
96 0.26
97 0.22
98 0.23
99 0.25
100 0.24
101 0.25
102 0.26
103 0.24
104 0.21
105 0.21
106 0.22
107 0.2
108 0.29
109 0.29
110 0.31
111 0.35
112 0.35
113 0.41
114 0.38
115 0.4
116 0.33
117 0.31
118 0.3
119 0.31
120 0.4
121 0.37
122 0.38
123 0.42
124 0.41
125 0.39
126 0.35
127 0.31
128 0.22
129 0.25
130 0.28
131 0.21
132 0.24
133 0.25
134 0.26
135 0.28
136 0.27
137 0.21
138 0.18
139 0.18
140 0.14
141 0.16
142 0.19
143 0.17
144 0.18
145 0.2
146 0.24
147 0.26
148 0.33
149 0.41
150 0.47
151 0.55
152 0.63
153 0.69
154 0.67
155 0.71
156 0.64
157 0.56
158 0.5
159 0.45
160 0.38
161 0.31
162 0.28
163 0.26
164 0.26
165 0.22
166 0.19
167 0.14
168 0.12
169 0.12
170 0.13
171 0.1
172 0.13
173 0.15
174 0.21
175 0.28
176 0.33
177 0.37
178 0.4
179 0.4
180 0.38
181 0.42
182 0.37
183 0.31
184 0.26
185 0.22
186 0.21
187 0.21
188 0.2
189 0.14
190 0.12
191 0.11
192 0.12
193 0.13
194 0.09
195 0.1
196 0.13
197 0.16
198 0.22
199 0.22
200 0.21
201 0.22
202 0.25
203 0.26
204 0.3
205 0.28
206 0.23
207 0.24
208 0.28