Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4F993

Protein Details
Accession A0A0C4F993    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-32QSESRRRRLLVCRIAQQNRRTHydrophilic
50-75SDEETRPPPKKMRQPNKDRDHLKHHEBasic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006912  Harbinger_derived_prot  
Pfam View protein in Pfam  
PF04827  Plant_tran  
Amino Acid Sequences MLRTSFLPFPDQSESRRRRLLVCRIAQQNRRTVQHILDSDLDDKLDSSDSDEETRPPPKKMRQPNKDRDHLKHHESMMKDYFSESSRYNSRDFCRRFCMERGLVVRIIEDLTKNYPYFVQKADCTGKLGLSPHQKITAAIRQLAYGLPLDATDKYCQLAETTARQNMEVFCGAIQEFYGPTYLRAPNHEDLKRILEENAARGFPGCIGSLDCMHWAWKNCPTESADRSPLFQSLLDGTPWGVEFQLGKNTYKMPYYLVDGIYNPWSTLIQSKSLSDTADRAKKIFVKRQESVQKDIEPILKTCTILHNMIVESRAEPKLYPLLASSTKLIPPRDTPYTILEQHVREIKMRSQLVNCKLTSDLIANLWDKAVQSDTSDDNTPNHNSDSSSEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.58
4 0.55
5 0.56
6 0.63
7 0.68
8 0.68
9 0.68
10 0.7
11 0.73
12 0.8
13 0.8
14 0.77
15 0.75
16 0.71
17 0.68
18 0.63
19 0.57
20 0.52
21 0.52
22 0.48
23 0.42
24 0.38
25 0.37
26 0.34
27 0.31
28 0.27
29 0.18
30 0.16
31 0.14
32 0.12
33 0.1
34 0.12
35 0.14
36 0.16
37 0.19
38 0.2
39 0.22
40 0.25
41 0.33
42 0.33
43 0.36
44 0.43
45 0.49
46 0.58
47 0.67
48 0.73
49 0.76
50 0.84
51 0.89
52 0.9
53 0.9
54 0.88
55 0.83
56 0.82
57 0.79
58 0.74
59 0.7
60 0.64
61 0.6
62 0.54
63 0.54
64 0.48
65 0.42
66 0.36
67 0.3
68 0.28
69 0.24
70 0.25
71 0.2
72 0.2
73 0.25
74 0.28
75 0.29
76 0.33
77 0.37
78 0.44
79 0.47
80 0.46
81 0.48
82 0.5
83 0.52
84 0.5
85 0.54
86 0.45
87 0.48
88 0.46
89 0.42
90 0.39
91 0.35
92 0.3
93 0.22
94 0.21
95 0.15
96 0.13
97 0.11
98 0.12
99 0.15
100 0.15
101 0.15
102 0.18
103 0.19
104 0.21
105 0.22
106 0.23
107 0.2
108 0.27
109 0.3
110 0.28
111 0.28
112 0.26
113 0.23
114 0.22
115 0.23
116 0.23
117 0.28
118 0.29
119 0.28
120 0.3
121 0.29
122 0.28
123 0.32
124 0.32
125 0.25
126 0.25
127 0.24
128 0.22
129 0.22
130 0.21
131 0.17
132 0.1
133 0.08
134 0.06
135 0.06
136 0.07
137 0.07
138 0.09
139 0.09
140 0.09
141 0.1
142 0.1
143 0.1
144 0.09
145 0.11
146 0.11
147 0.15
148 0.18
149 0.2
150 0.2
151 0.2
152 0.21
153 0.19
154 0.19
155 0.14
156 0.11
157 0.08
158 0.09
159 0.09
160 0.07
161 0.07
162 0.05
163 0.05
164 0.05
165 0.06
166 0.05
167 0.06
168 0.1
169 0.13
170 0.13
171 0.15
172 0.2
173 0.23
174 0.3
175 0.31
176 0.28
177 0.28
178 0.3
179 0.28
180 0.24
181 0.21
182 0.16
183 0.16
184 0.17
185 0.17
186 0.14
187 0.13
188 0.12
189 0.12
190 0.09
191 0.1
192 0.07
193 0.06
194 0.06
195 0.07
196 0.08
197 0.08
198 0.09
199 0.08
200 0.08
201 0.11
202 0.12
203 0.14
204 0.19
205 0.22
206 0.22
207 0.24
208 0.26
209 0.3
210 0.32
211 0.34
212 0.34
213 0.31
214 0.33
215 0.31
216 0.29
217 0.24
218 0.19
219 0.15
220 0.12
221 0.12
222 0.11
223 0.1
224 0.09
225 0.09
226 0.09
227 0.08
228 0.05
229 0.05
230 0.06
231 0.07
232 0.14
233 0.15
234 0.16
235 0.17
236 0.19
237 0.2
238 0.2
239 0.19
240 0.15
241 0.14
242 0.18
243 0.19
244 0.18
245 0.17
246 0.17
247 0.18
248 0.18
249 0.17
250 0.13
251 0.11
252 0.1
253 0.1
254 0.14
255 0.14
256 0.16
257 0.16
258 0.17
259 0.2
260 0.21
261 0.21
262 0.16
263 0.19
264 0.23
265 0.28
266 0.28
267 0.26
268 0.29
269 0.35
270 0.41
271 0.46
272 0.47
273 0.49
274 0.5
275 0.59
276 0.65
277 0.63
278 0.62
279 0.58
280 0.51
281 0.45
282 0.46
283 0.42
284 0.34
285 0.31
286 0.29
287 0.25
288 0.24
289 0.23
290 0.25
291 0.23
292 0.22
293 0.22
294 0.2
295 0.2
296 0.2
297 0.2
298 0.16
299 0.13
300 0.17
301 0.17
302 0.15
303 0.15
304 0.17
305 0.21
306 0.21
307 0.2
308 0.17
309 0.21
310 0.22
311 0.24
312 0.24
313 0.21
314 0.24
315 0.29
316 0.3
317 0.28
318 0.31
319 0.36
320 0.39
321 0.39
322 0.38
323 0.38
324 0.42
325 0.41
326 0.4
327 0.39
328 0.34
329 0.36
330 0.4
331 0.36
332 0.33
333 0.35
334 0.36
335 0.4
336 0.42
337 0.42
338 0.43
339 0.51
340 0.55
341 0.58
342 0.53
343 0.46
344 0.43
345 0.4
346 0.35
347 0.28
348 0.22
349 0.17
350 0.21
351 0.2
352 0.19
353 0.19
354 0.17
355 0.15
356 0.15
357 0.16
358 0.13
359 0.14
360 0.17
361 0.19
362 0.22
363 0.24
364 0.24
365 0.24
366 0.28
367 0.3
368 0.3
369 0.3
370 0.27
371 0.26
372 0.26