Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A161HL00

Protein Details
Accession A0A161HL00   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-114SDAGRQARKERRSANRQKIKMNNFLAHydrophilic
NLS Segment(s)
PositionSequence
96-102RKERRSA
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG slb:AWJ20_4808  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLRLITRQVLRTTVPRTSFVRLASTSAPNTETTSSTKKTITSIAPAGTKLKGLNIKKGGEDPIALAENEYPEWLWELLDPAAQKAKLESDAGRQARKERRSANRQKIKMNNFLAGMKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.39
4 0.41
5 0.42
6 0.36
7 0.36
8 0.3
9 0.31
10 0.3
11 0.31
12 0.26
13 0.24
14 0.24
15 0.2
16 0.21
17 0.2
18 0.18
19 0.19
20 0.23
21 0.24
22 0.25
23 0.25
24 0.24
25 0.24
26 0.26
27 0.23
28 0.22
29 0.22
30 0.22
31 0.22
32 0.22
33 0.22
34 0.18
35 0.17
36 0.13
37 0.14
38 0.2
39 0.2
40 0.26
41 0.29
42 0.3
43 0.29
44 0.31
45 0.29
46 0.22
47 0.21
48 0.14
49 0.11
50 0.11
51 0.1
52 0.09
53 0.08
54 0.08
55 0.07
56 0.07
57 0.05
58 0.05
59 0.06
60 0.06
61 0.06
62 0.05
63 0.07
64 0.07
65 0.09
66 0.09
67 0.09
68 0.12
69 0.12
70 0.12
71 0.11
72 0.13
73 0.13
74 0.15
75 0.15
76 0.18
77 0.27
78 0.31
79 0.33
80 0.33
81 0.4
82 0.47
83 0.51
84 0.53
85 0.53
86 0.61
87 0.69
88 0.78
89 0.81
90 0.82
91 0.83
92 0.85
93 0.85
94 0.82
95 0.81
96 0.74
97 0.67
98 0.58