Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A170QYL7

Protein Details
Accession A0A170QYL7   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
250-272DTSKDKLLSKKSKSDMRKRGKKSBasic
NLS Segment(s)
PositionSequence
258-272SKKSKSDMRKRGKKS
Subcellular Location(s) nucl 9, plas 6, cyto 4, E.R. 4, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021013  ATPase_Vma12  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
KEGG slb:AWJ20_3633  -  
Pfam View protein in Pfam  
PF11712  Vma12  
Amino Acid Sequences MVLLVATKRIERALETYNELEGSVSKIDEALDKKDENKALTTTASTSQREPAIEHDRLVIISKSLIARYPDNAEYRLAALVKGTYVYNPPKPPAPPKSEEFLKQMERLRNEEAEREYQRMINPELALAISSGSESVPSIGQEAKQLKEQLSAIVNIMVSVASVAAAIWYWSGSSAGFSTPTRTLLSLFGAITVLIAEVVVYLRYKVRVEEAKVLERNKKEKKSIVSTVDLADSAQSIISLNLDNSSTSVDTSKDKLLSKKSKSDMRKRGKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.31
4 0.3
5 0.29
6 0.26
7 0.22
8 0.16
9 0.15
10 0.12
11 0.1
12 0.09
13 0.09
14 0.1
15 0.15
16 0.17
17 0.19
18 0.22
19 0.24
20 0.26
21 0.32
22 0.34
23 0.31
24 0.31
25 0.28
26 0.26
27 0.26
28 0.26
29 0.22
30 0.25
31 0.28
32 0.27
33 0.27
34 0.29
35 0.29
36 0.29
37 0.27
38 0.29
39 0.31
40 0.3
41 0.29
42 0.27
43 0.25
44 0.25
45 0.26
46 0.19
47 0.11
48 0.1
49 0.12
50 0.12
51 0.12
52 0.15
53 0.15
54 0.16
55 0.18
56 0.23
57 0.25
58 0.26
59 0.26
60 0.24
61 0.22
62 0.21
63 0.2
64 0.16
65 0.12
66 0.1
67 0.09
68 0.08
69 0.08
70 0.08
71 0.07
72 0.12
73 0.17
74 0.22
75 0.24
76 0.26
77 0.29
78 0.32
79 0.4
80 0.42
81 0.45
82 0.43
83 0.44
84 0.48
85 0.48
86 0.48
87 0.42
88 0.39
89 0.35
90 0.35
91 0.38
92 0.37
93 0.36
94 0.37
95 0.36
96 0.35
97 0.33
98 0.32
99 0.29
100 0.3
101 0.29
102 0.28
103 0.26
104 0.24
105 0.24
106 0.23
107 0.22
108 0.18
109 0.16
110 0.14
111 0.14
112 0.12
113 0.1
114 0.07
115 0.06
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.04
123 0.04
124 0.04
125 0.05
126 0.05
127 0.06
128 0.11
129 0.13
130 0.13
131 0.16
132 0.18
133 0.17
134 0.19
135 0.19
136 0.16
137 0.15
138 0.15
139 0.12
140 0.11
141 0.11
142 0.08
143 0.08
144 0.06
145 0.04
146 0.04
147 0.03
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.03
155 0.03
156 0.03
157 0.03
158 0.04
159 0.04
160 0.04
161 0.05
162 0.05
163 0.08
164 0.08
165 0.11
166 0.12
167 0.14
168 0.14
169 0.14
170 0.14
171 0.14
172 0.15
173 0.13
174 0.12
175 0.11
176 0.1
177 0.09
178 0.08
179 0.07
180 0.05
181 0.03
182 0.03
183 0.02
184 0.03
185 0.03
186 0.04
187 0.04
188 0.05
189 0.06
190 0.09
191 0.09
192 0.1
193 0.17
194 0.22
195 0.26
196 0.34
197 0.37
198 0.43
199 0.48
200 0.51
201 0.52
202 0.52
203 0.58
204 0.59
205 0.62
206 0.61
207 0.63
208 0.68
209 0.69
210 0.71
211 0.66
212 0.61
213 0.55
214 0.5
215 0.43
216 0.35
217 0.26
218 0.18
219 0.13
220 0.09
221 0.07
222 0.06
223 0.05
224 0.05
225 0.07
226 0.07
227 0.07
228 0.08
229 0.09
230 0.09
231 0.09
232 0.12
233 0.11
234 0.11
235 0.12
236 0.13
237 0.16
238 0.19
239 0.23
240 0.25
241 0.29
242 0.35
243 0.45
244 0.53
245 0.57
246 0.64
247 0.67
248 0.72
249 0.78
250 0.82
251 0.82
252 0.84