Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167EAF4

Protein Details
Accession A0A167EAF4    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAIFSKNKKNKKDGARNSVVPKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015915  Kelch-typ_b-propeller  
KEGG slb:AWJ20_4781  -  
Amino Acid Sequences MAIFSKNKKNKKDGARNSVVPKAFEGAKDALVGGAGGEEGSSPTQRQVSGASTVSSTNSMISGNGSQSPHNGHGAGNVPNIANTISNLYSGPGSSGPYPGRSPGSGSGGPNGASPQNRNYPQSGSRSNSAMSGHGPNGSSGGVRSPPGSRNATSPMGQQYPGGQQQWGGQQQWQQSPQQQQLHHQQSVPSNLRSQSSPHPSSQPQYPWSRHTISNSSPFPRHGHAANAVAARDGEVFVMGGLKGSNVFGDLWVIESGKSVGGQDASGGRALPGPVCARFASPKGTGCLRRPGAARTRCAPLRGAVKGSLGLAKRAQTGPGSARPPEAAKAPEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.83
4 0.8
5 0.79
6 0.7
7 0.59
8 0.5
9 0.43
10 0.37
11 0.3
12 0.29
13 0.23
14 0.22
15 0.21
16 0.19
17 0.15
18 0.13
19 0.12
20 0.07
21 0.05
22 0.04
23 0.03
24 0.03
25 0.03
26 0.05
27 0.06
28 0.08
29 0.08
30 0.11
31 0.13
32 0.14
33 0.15
34 0.16
35 0.18
36 0.21
37 0.21
38 0.19
39 0.18
40 0.19
41 0.19
42 0.17
43 0.14
44 0.1
45 0.1
46 0.09
47 0.09
48 0.1
49 0.11
50 0.11
51 0.15
52 0.16
53 0.16
54 0.17
55 0.21
56 0.21
57 0.22
58 0.21
59 0.16
60 0.19
61 0.22
62 0.22
63 0.19
64 0.18
65 0.16
66 0.15
67 0.16
68 0.13
69 0.1
70 0.08
71 0.1
72 0.09
73 0.1
74 0.1
75 0.1
76 0.1
77 0.09
78 0.1
79 0.08
80 0.09
81 0.09
82 0.13
83 0.14
84 0.16
85 0.17
86 0.18
87 0.2
88 0.18
89 0.21
90 0.19
91 0.24
92 0.24
93 0.24
94 0.23
95 0.22
96 0.22
97 0.19
98 0.18
99 0.15
100 0.14
101 0.15
102 0.18
103 0.25
104 0.28
105 0.29
106 0.3
107 0.32
108 0.35
109 0.39
110 0.4
111 0.35
112 0.35
113 0.34
114 0.32
115 0.29
116 0.26
117 0.2
118 0.16
119 0.16
120 0.14
121 0.14
122 0.14
123 0.12
124 0.12
125 0.11
126 0.09
127 0.07
128 0.08
129 0.07
130 0.08
131 0.09
132 0.11
133 0.13
134 0.17
135 0.2
136 0.2
137 0.21
138 0.25
139 0.26
140 0.25
141 0.25
142 0.24
143 0.22
144 0.21
145 0.19
146 0.16
147 0.17
148 0.2
149 0.18
150 0.14
151 0.13
152 0.15
153 0.2
154 0.2
155 0.17
156 0.16
157 0.19
158 0.23
159 0.25
160 0.25
161 0.22
162 0.25
163 0.3
164 0.35
165 0.37
166 0.34
167 0.36
168 0.45
169 0.49
170 0.45
171 0.41
172 0.37
173 0.34
174 0.41
175 0.39
176 0.3
177 0.27
178 0.27
179 0.27
180 0.25
181 0.25
182 0.25
183 0.3
184 0.32
185 0.31
186 0.35
187 0.35
188 0.37
189 0.4
190 0.36
191 0.33
192 0.37
193 0.38
194 0.38
195 0.41
196 0.42
197 0.38
198 0.39
199 0.39
200 0.36
201 0.42
202 0.42
203 0.4
204 0.38
205 0.38
206 0.36
207 0.34
208 0.32
209 0.25
210 0.25
211 0.24
212 0.25
213 0.26
214 0.24
215 0.21
216 0.19
217 0.18
218 0.15
219 0.12
220 0.09
221 0.06
222 0.05
223 0.05
224 0.04
225 0.05
226 0.05
227 0.05
228 0.04
229 0.04
230 0.05
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.06
238 0.07
239 0.08
240 0.08
241 0.07
242 0.08
243 0.08
244 0.08
245 0.08
246 0.07
247 0.07
248 0.08
249 0.08
250 0.08
251 0.09
252 0.1
253 0.1
254 0.09
255 0.09
256 0.1
257 0.1
258 0.09
259 0.12
260 0.14
261 0.14
262 0.17
263 0.17
264 0.18
265 0.21
266 0.23
267 0.25
268 0.26
269 0.28
270 0.3
271 0.37
272 0.4
273 0.41
274 0.49
275 0.45
276 0.47
277 0.47
278 0.5
279 0.53
280 0.54
281 0.55
282 0.49
283 0.55
284 0.53
285 0.52
286 0.47
287 0.43
288 0.44
289 0.42
290 0.41
291 0.35
292 0.33
293 0.32
294 0.31
295 0.3
296 0.24
297 0.24
298 0.23
299 0.24
300 0.27
301 0.27
302 0.28
303 0.25
304 0.29
305 0.31
306 0.36
307 0.38
308 0.35
309 0.36
310 0.37
311 0.38
312 0.35
313 0.35