Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DFG6

Protein Details
Accession A0A0C4DFG6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTKSADPKTANKKRQAKRTEFLHydrophilic
138-194KQNKQPTKESTKRDPKKPYKIPKINQSKAQPSGLKPKPYKRKPNKGNNKWKETFRMAHydrophilic
NLS Segment(s)
PositionSequence
134-188IKVIKQNKQPTKESTKRDPKKPYKIPKINQSKAQPSGLKPKPYKRKPNKGNNKWK
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MTKSADPKTANKKRQAKRTEFLPPGFFLSPYQDKKRPHPATLPARIIKKQFDPKAAALKLLKVLNKAQEDAIAIFKATKAAYLNAKNYDKVELLKSYLEQVISLFRVVQKFLPWKEILAKHSDGWNPYTERKHIKVIKQNKQPTKESTKRDPKKPYKIPKINQSKAQPSGLKPKPYKRKPNKGNNKWKETFRMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.84
4 0.79
5 0.78
6 0.78
7 0.74
8 0.69
9 0.62
10 0.53
11 0.49
12 0.44
13 0.37
14 0.28
15 0.29
16 0.33
17 0.37
18 0.43
19 0.45
20 0.48
21 0.55
22 0.66
23 0.64
24 0.6
25 0.61
26 0.63
27 0.66
28 0.71
29 0.7
30 0.64
31 0.63
32 0.62
33 0.57
34 0.51
35 0.5
36 0.51
37 0.48
38 0.48
39 0.48
40 0.48
41 0.54
42 0.5
43 0.46
44 0.37
45 0.34
46 0.33
47 0.31
48 0.29
49 0.23
50 0.25
51 0.27
52 0.27
53 0.27
54 0.22
55 0.2
56 0.2
57 0.18
58 0.17
59 0.11
60 0.09
61 0.09
62 0.08
63 0.09
64 0.08
65 0.08
66 0.07
67 0.1
68 0.16
69 0.19
70 0.22
71 0.26
72 0.28
73 0.27
74 0.27
75 0.27
76 0.22
77 0.2
78 0.19
79 0.14
80 0.14
81 0.13
82 0.13
83 0.12
84 0.12
85 0.11
86 0.08
87 0.08
88 0.08
89 0.08
90 0.08
91 0.07
92 0.08
93 0.08
94 0.09
95 0.09
96 0.12
97 0.17
98 0.18
99 0.22
100 0.2
101 0.21
102 0.27
103 0.3
104 0.28
105 0.27
106 0.28
107 0.25
108 0.29
109 0.3
110 0.25
111 0.23
112 0.25
113 0.23
114 0.27
115 0.29
116 0.29
117 0.33
118 0.35
119 0.42
120 0.45
121 0.5
122 0.55
123 0.62
124 0.67
125 0.71
126 0.78
127 0.77
128 0.77
129 0.74
130 0.72
131 0.72
132 0.7
133 0.67
134 0.69
135 0.72
136 0.75
137 0.79
138 0.83
139 0.82
140 0.85
141 0.88
142 0.88
143 0.88
144 0.9
145 0.89
146 0.88
147 0.89
148 0.84
149 0.82
150 0.79
151 0.76
152 0.7
153 0.69
154 0.63
155 0.57
156 0.61
157 0.6
158 0.61
159 0.61
160 0.67
161 0.71
162 0.77
163 0.84
164 0.85
165 0.89
166 0.9
167 0.94
168 0.95
169 0.95
170 0.96
171 0.95
172 0.94
173 0.89
174 0.85