Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FCM2

Protein Details
Accession A0A0C4FCM2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
143-169SNEILVRKLRRRRTVRIRHLRRCDGVGHydrophilic
NLS Segment(s)
PositionSequence
150-158KLRRRRTVR
Subcellular Location(s) mito 22, cyto 3.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences LRRDSVIAKAAARLKESCAKAVRYWDRRCSHCLRDSLRKGELVLLYNRSLESQWGKLFANRWNGPYCVVSQFPGGSYQLEELDGMLLKRRAAGTHVKRFYARGSTGFDQTAESDDSEEEVWVPEDAFSSASSEGAEGTGAAASNEILVRKLRRRRTVRIRHLRRCDGVGVCGPLGTALKRLVRGKPWQAKATSDYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.38
4 0.39
5 0.39
6 0.4
7 0.4
8 0.49
9 0.55
10 0.56
11 0.61
12 0.64
13 0.65
14 0.66
15 0.7
16 0.67
17 0.65
18 0.62
19 0.63
20 0.6
21 0.65
22 0.68
23 0.67
24 0.62
25 0.55
26 0.48
27 0.45
28 0.4
29 0.33
30 0.29
31 0.26
32 0.24
33 0.24
34 0.23
35 0.19
36 0.17
37 0.17
38 0.17
39 0.17
40 0.17
41 0.19
42 0.2
43 0.21
44 0.24
45 0.26
46 0.32
47 0.3
48 0.32
49 0.32
50 0.32
51 0.32
52 0.3
53 0.26
54 0.19
55 0.18
56 0.16
57 0.15
58 0.14
59 0.13
60 0.13
61 0.12
62 0.09
63 0.09
64 0.09
65 0.08
66 0.08
67 0.08
68 0.06
69 0.06
70 0.06
71 0.05
72 0.07
73 0.07
74 0.07
75 0.08
76 0.09
77 0.08
78 0.11
79 0.21
80 0.27
81 0.36
82 0.37
83 0.37
84 0.38
85 0.38
86 0.37
87 0.32
88 0.25
89 0.18
90 0.22
91 0.22
92 0.23
93 0.23
94 0.21
95 0.17
96 0.16
97 0.15
98 0.11
99 0.09
100 0.08
101 0.08
102 0.08
103 0.08
104 0.08
105 0.06
106 0.05
107 0.06
108 0.05
109 0.06
110 0.05
111 0.05
112 0.06
113 0.06
114 0.06
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.06
121 0.06
122 0.05
123 0.03
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.06
134 0.1
135 0.15
136 0.24
137 0.33
138 0.42
139 0.51
140 0.59
141 0.68
142 0.77
143 0.83
144 0.85
145 0.88
146 0.9
147 0.9
148 0.92
149 0.89
150 0.81
151 0.73
152 0.67
153 0.58
154 0.51
155 0.44
156 0.37
157 0.29
158 0.26
159 0.22
160 0.17
161 0.17
162 0.14
163 0.13
164 0.15
165 0.18
166 0.24
167 0.29
168 0.33
169 0.39
170 0.47
171 0.55
172 0.61
173 0.65
174 0.66
175 0.65
176 0.64