Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167EZQ6

Protein Details
Accession A0A167EZQ6   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
116-137LAPELAKKLKIKKDKQTQEQDPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12, mito 9.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007529  Znf_HIT  
IPR039646  ZNHIT2  
KEGG slb:AWJ20_2249  -  
Pfam View protein in Pfam  
PF04438  zf-HIT  
PROSITE View protein in PROSITE  
PS51083  ZF_HIT  
Amino Acid Sequences MIIPNSSLGSESVPKRPYEQLKPVGLGSKFSKAPSASDYLCSLCEASPAKYTCPKCLKLYCSLDCYKGPNHVKCSKLFQESKEQPAEKSSKEEQAKMLKILEDFNLAEPNGWKYELAPELAKKLKIKKDKQTQEQDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.4
4 0.46
5 0.48
6 0.54
7 0.54
8 0.55
9 0.56
10 0.54
11 0.52
12 0.44
13 0.4
14 0.33
15 0.31
16 0.29
17 0.27
18 0.3
19 0.24
20 0.26
21 0.25
22 0.27
23 0.22
24 0.22
25 0.24
26 0.2
27 0.2
28 0.18
29 0.15
30 0.11
31 0.14
32 0.13
33 0.13
34 0.18
35 0.19
36 0.21
37 0.28
38 0.29
39 0.34
40 0.39
41 0.4
42 0.4
43 0.44
44 0.45
45 0.46
46 0.52
47 0.46
48 0.44
49 0.43
50 0.4
51 0.35
52 0.34
53 0.27
54 0.29
55 0.33
56 0.31
57 0.36
58 0.39
59 0.4
60 0.39
61 0.45
62 0.41
63 0.42
64 0.41
65 0.37
66 0.42
67 0.44
68 0.47
69 0.46
70 0.42
71 0.35
72 0.38
73 0.39
74 0.29
75 0.32
76 0.29
77 0.32
78 0.34
79 0.35
80 0.35
81 0.4
82 0.41
83 0.36
84 0.35
85 0.28
86 0.26
87 0.26
88 0.22
89 0.17
90 0.15
91 0.15
92 0.16
93 0.14
94 0.15
95 0.14
96 0.16
97 0.15
98 0.15
99 0.13
100 0.12
101 0.18
102 0.19
103 0.2
104 0.21
105 0.21
106 0.27
107 0.31
108 0.35
109 0.34
110 0.42
111 0.49
112 0.56
113 0.64
114 0.68
115 0.75
116 0.81
117 0.86