Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167E776

Protein Details
Accession A0A167E776    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
70-91QYVGKAPKVKRREQTRERKALVHydrophilic
207-245DEDEQETKTRKRKPTPAKKPKSDKKKPRRGPRVEIEYEQBasic
NLS Segment(s)
PositionSequence
74-89KAPKVKRREQTRERKA
214-238KTRKRKPTPAKKPKSDKKKPRRGPR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018247  EF_Hand_1_Ca_BS  
IPR029004  L28e/Mak16  
IPR006958  Mak16  
Gene Ontology GO:0005730  C:nucleolus  
KEGG slb:AWJ20_4670  -  
Pfam View protein in Pfam  
PF04874  Mak16  
PF01778  Ribosomal_L28e  
PROSITE View protein in PROSITE  
PS00018  EF_HAND_1  
Amino Acid Sequences MKTAERAHTPAKLWERVKLSKQYSKALEQIDQQLIYWPNFLIHKCKQRLTRLTQVAITERRLALKENERQYVGKAPKVKRREQTRERKALVAAKLEKAIEKELLDRLKTGAYGENPLNVDEKIWKKVLNGVEKEEGVEQEEEFDEDEELEDESDVGEVEFVEGDDDEDDIVELEDLEKWLGGSDDDGEQRFDSSEDESSSDEESEDDEDEQETKTRKRKPTPAKKPKSDKKKPRRGPRVEIEYEQERESNLQTNVNW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.54
3 0.56
4 0.61
5 0.62
6 0.63
7 0.62
8 0.65
9 0.66
10 0.63
11 0.61
12 0.59
13 0.53
14 0.48
15 0.44
16 0.46
17 0.42
18 0.37
19 0.32
20 0.32
21 0.31
22 0.29
23 0.25
24 0.19
25 0.17
26 0.2
27 0.22
28 0.24
29 0.29
30 0.38
31 0.42
32 0.49
33 0.55
34 0.61
35 0.69
36 0.69
37 0.71
38 0.68
39 0.65
40 0.6
41 0.55
42 0.52
43 0.46
44 0.4
45 0.33
46 0.28
47 0.27
48 0.26
49 0.26
50 0.27
51 0.32
52 0.38
53 0.4
54 0.43
55 0.42
56 0.42
57 0.42
58 0.44
59 0.38
60 0.35
61 0.38
62 0.42
63 0.49
64 0.55
65 0.61
66 0.6
67 0.68
68 0.73
69 0.76
70 0.81
71 0.82
72 0.85
73 0.79
74 0.73
75 0.65
76 0.6
77 0.53
78 0.49
79 0.41
80 0.33
81 0.32
82 0.3
83 0.28
84 0.23
85 0.21
86 0.15
87 0.13
88 0.14
89 0.17
90 0.19
91 0.18
92 0.17
93 0.16
94 0.15
95 0.14
96 0.13
97 0.12
98 0.11
99 0.13
100 0.13
101 0.15
102 0.15
103 0.15
104 0.15
105 0.12
106 0.12
107 0.14
108 0.16
109 0.16
110 0.17
111 0.17
112 0.16
113 0.22
114 0.27
115 0.28
116 0.28
117 0.28
118 0.29
119 0.28
120 0.28
121 0.23
122 0.18
123 0.12
124 0.11
125 0.08
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.04
138 0.04
139 0.04
140 0.04
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.03
157 0.04
158 0.03
159 0.03
160 0.03
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.05
168 0.04
169 0.05
170 0.06
171 0.08
172 0.1
173 0.11
174 0.12
175 0.12
176 0.12
177 0.12
178 0.11
179 0.1
180 0.1
181 0.12
182 0.12
183 0.13
184 0.13
185 0.14
186 0.14
187 0.13
188 0.11
189 0.1
190 0.1
191 0.1
192 0.1
193 0.09
194 0.09
195 0.09
196 0.1
197 0.11
198 0.14
199 0.16
200 0.22
201 0.29
202 0.38
203 0.47
204 0.56
205 0.66
206 0.73
207 0.81
208 0.86
209 0.9
210 0.92
211 0.93
212 0.95
213 0.95
214 0.95
215 0.94
216 0.94
217 0.94
218 0.95
219 0.95
220 0.95
221 0.95
222 0.94
223 0.92
224 0.91
225 0.9
226 0.84
227 0.77
228 0.72
229 0.67
230 0.6
231 0.52
232 0.42
233 0.33
234 0.29
235 0.28
236 0.29
237 0.24