Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167D802

Protein Details
Accession A0A167D802    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
66-93NEAIRCGKWKFRDKKLRDRVLKIYQKRNHydrophilic
NLS Segment(s)
PositionSequence
78-80DKK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013882  Ctp1_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0006281  P:DNA repair  
KEGG slb:AWJ20_848  -  
Pfam View protein in Pfam  
PF08573  SAE2  
Amino Acid Sequences MTGNGAYKTLTVDEMVDRGSRHRDRFSSQETPAGYYRADMQDSLEEQEYKAQQEQARELEAKKRFNEAIRCGKWKFRDKKLRDRVLKIYQKRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.12
5 0.14
6 0.22
7 0.27
8 0.3
9 0.35
10 0.37
11 0.4
12 0.46
13 0.51
14 0.49
15 0.44
16 0.45
17 0.4
18 0.4
19 0.36
20 0.3
21 0.23
22 0.16
23 0.18
24 0.15
25 0.15
26 0.12
27 0.12
28 0.12
29 0.13
30 0.14
31 0.12
32 0.1
33 0.1
34 0.13
35 0.12
36 0.12
37 0.12
38 0.14
39 0.15
40 0.17
41 0.2
42 0.18
43 0.2
44 0.2
45 0.21
46 0.25
47 0.29
48 0.32
49 0.3
50 0.33
51 0.33
52 0.38
53 0.45
54 0.44
55 0.5
56 0.5
57 0.54
58 0.52
59 0.57
60 0.59
61 0.62
62 0.64
63 0.64
64 0.7
65 0.72
66 0.82
67 0.86
68 0.88
69 0.86
70 0.84
71 0.82
72 0.82
73 0.85