Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167FU86

Protein Details
Accession A0A167FU86    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
119-168YAKFVLKDEKKKPQQSKPKKKFRYLTKVERKAHVSKERSRNRQKRDKFKKBasic
NLS Segment(s)
PositionSequence
127-168EKKKPQQSKPKKKFRYLTKVERKAHVSKERSRNRQKRDKFKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
KEGG slb:AWJ20_3348  -  
Amino Acid Sequences MKRFQEAMKDLNGEVSDDGDDEWTDIKKTKEVKSTKVSEEVSSEKDSDDEPEGESWAGFDSESRPNGILKKKQTFDDDDDGTVVVTIEDLSEPLHIDKYVDVDKSESVLEGSINRAQEYAKFVLKDEKKKPQQSKPKKKFRYLTKVERKAHVSKERSRNRQKRDKFKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.13
4 0.11
5 0.11
6 0.09
7 0.08
8 0.08
9 0.09
10 0.09
11 0.1
12 0.13
13 0.14
14 0.19
15 0.25
16 0.31
17 0.39
18 0.43
19 0.49
20 0.54
21 0.59
22 0.57
23 0.58
24 0.53
25 0.45
26 0.44
27 0.39
28 0.34
29 0.3
30 0.27
31 0.2
32 0.19
33 0.18
34 0.17
35 0.17
36 0.14
37 0.13
38 0.13
39 0.13
40 0.13
41 0.12
42 0.1
43 0.07
44 0.07
45 0.05
46 0.05
47 0.08
48 0.12
49 0.13
50 0.13
51 0.13
52 0.15
53 0.2
54 0.27
55 0.3
56 0.33
57 0.4
58 0.41
59 0.44
60 0.46
61 0.45
62 0.43
63 0.42
64 0.35
65 0.28
66 0.26
67 0.23
68 0.2
69 0.15
70 0.1
71 0.04
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.05
82 0.05
83 0.06
84 0.06
85 0.08
86 0.1
87 0.11
88 0.1
89 0.11
90 0.11
91 0.12
92 0.12
93 0.09
94 0.07
95 0.07
96 0.07
97 0.06
98 0.09
99 0.1
100 0.11
101 0.11
102 0.11
103 0.11
104 0.12
105 0.17
106 0.17
107 0.18
108 0.18
109 0.19
110 0.28
111 0.34
112 0.42
113 0.44
114 0.52
115 0.59
116 0.68
117 0.76
118 0.77
119 0.82
120 0.85
121 0.89
122 0.89
123 0.91
124 0.91
125 0.91
126 0.9
127 0.9
128 0.89
129 0.87
130 0.88
131 0.88
132 0.89
133 0.84
134 0.81
135 0.76
136 0.72
137 0.72
138 0.71
139 0.68
140 0.67
141 0.74
142 0.78
143 0.82
144 0.86
145 0.86
146 0.87
147 0.9
148 0.91