Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A161HIA9

Protein Details
Accession A0A161HIA9    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
58-77EAEKKRKKELDEANRKKSSRBasic
NLS Segment(s)
PositionSequence
29-75MTKSAAAKLQKKEAAERKKAERLASKMAAEAEKKRKKELDEANRKKS
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042530  EME1/EME2_C  
IPR006166  ERCC4_domain  
IPR033310  Mms4/EME1/EME2  
Gene Ontology GO:0048476  C:Holliday junction resolvase complex  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0004518  F:nuclease activity  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
GO:0051321  P:meiotic cell cycle  
KEGG slb:AWJ20_405  -  
Pfam View protein in Pfam  
PF02732  ERCC4  
Amino Acid Sequences MKESNSGDCLGETRELGTEEEPEPRSAKMTKSAAAKLQKKEAAERKKAERLASKMAAEAEKKRKKELDEANRKKSSRSSCAKEIIIKFGKDFAKSELGSVIKQQSEELGCDIKEVDRAEESENGIYYSITFDRKVTNRFDPEQDMYVPIPLEIKPENVVVIYMEGKKAVDIFLNTDKKKQHLETIDAAYREYQVLYIIEGLHAQLKKADLELDKKFADRVRQLVAGQATAVEATTNIISDRPSKIAWDSLIELEITKNCRLCHTKSREESAEMILGFAMDIGSRHYKARELLASETLDMIGTVRSGTSIQDTLSKSLEQIKYVTPVVSKSVASVYNNMFGLMESIDKRGTEALEGLRKESGTRSTKVVGSSLAKSICKILQSKDPDQYLQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.17
5 0.18
6 0.17
7 0.24
8 0.24
9 0.25
10 0.25
11 0.24
12 0.27
13 0.26
14 0.28
15 0.3
16 0.32
17 0.35
18 0.4
19 0.44
20 0.48
21 0.55
22 0.6
23 0.56
24 0.61
25 0.59
26 0.55
27 0.61
28 0.63
29 0.64
30 0.65
31 0.67
32 0.66
33 0.72
34 0.73
35 0.7
36 0.69
37 0.64
38 0.64
39 0.61
40 0.53
41 0.47
42 0.46
43 0.43
44 0.38
45 0.42
46 0.44
47 0.47
48 0.48
49 0.53
50 0.55
51 0.55
52 0.61
53 0.63
54 0.63
55 0.67
56 0.75
57 0.78
58 0.8
59 0.77
60 0.69
61 0.67
62 0.64
63 0.62
64 0.62
65 0.6
66 0.6
67 0.65
68 0.65
69 0.65
70 0.58
71 0.57
72 0.53
73 0.46
74 0.39
75 0.4
76 0.4
77 0.34
78 0.33
79 0.27
80 0.29
81 0.28
82 0.28
83 0.26
84 0.25
85 0.23
86 0.25
87 0.26
88 0.2
89 0.2
90 0.19
91 0.18
92 0.18
93 0.19
94 0.17
95 0.15
96 0.14
97 0.14
98 0.15
99 0.12
100 0.14
101 0.14
102 0.13
103 0.12
104 0.14
105 0.16
106 0.17
107 0.18
108 0.16
109 0.15
110 0.14
111 0.13
112 0.11
113 0.09
114 0.09
115 0.1
116 0.11
117 0.11
118 0.12
119 0.18
120 0.22
121 0.25
122 0.28
123 0.33
124 0.37
125 0.39
126 0.42
127 0.41
128 0.39
129 0.37
130 0.32
131 0.27
132 0.22
133 0.2
134 0.17
135 0.12
136 0.12
137 0.09
138 0.12
139 0.1
140 0.11
141 0.11
142 0.11
143 0.11
144 0.1
145 0.1
146 0.07
147 0.07
148 0.09
149 0.08
150 0.08
151 0.08
152 0.08
153 0.08
154 0.08
155 0.07
156 0.06
157 0.06
158 0.1
159 0.18
160 0.25
161 0.25
162 0.29
163 0.3
164 0.31
165 0.35
166 0.33
167 0.31
168 0.28
169 0.32
170 0.31
171 0.34
172 0.34
173 0.3
174 0.29
175 0.23
176 0.2
177 0.16
178 0.11
179 0.07
180 0.05
181 0.05
182 0.05
183 0.06
184 0.05
185 0.05
186 0.05
187 0.05
188 0.08
189 0.08
190 0.08
191 0.08
192 0.09
193 0.09
194 0.09
195 0.12
196 0.11
197 0.16
198 0.18
199 0.2
200 0.2
201 0.2
202 0.22
203 0.21
204 0.24
205 0.21
206 0.22
207 0.22
208 0.23
209 0.23
210 0.25
211 0.23
212 0.17
213 0.15
214 0.12
215 0.09
216 0.07
217 0.07
218 0.03
219 0.03
220 0.04
221 0.04
222 0.04
223 0.04
224 0.05
225 0.06
226 0.09
227 0.1
228 0.11
229 0.12
230 0.13
231 0.14
232 0.15
233 0.15
234 0.15
235 0.14
236 0.13
237 0.13
238 0.12
239 0.11
240 0.1
241 0.12
242 0.13
243 0.13
244 0.15
245 0.15
246 0.21
247 0.25
248 0.3
249 0.38
250 0.44
251 0.52
252 0.54
253 0.6
254 0.57
255 0.54
256 0.51
257 0.42
258 0.36
259 0.26
260 0.22
261 0.15
262 0.12
263 0.1
264 0.08
265 0.06
266 0.03
267 0.03
268 0.06
269 0.1
270 0.11
271 0.13
272 0.14
273 0.17
274 0.18
275 0.23
276 0.24
277 0.24
278 0.25
279 0.28
280 0.28
281 0.25
282 0.24
283 0.18
284 0.15
285 0.11
286 0.09
287 0.05
288 0.05
289 0.04
290 0.04
291 0.05
292 0.05
293 0.06
294 0.09
295 0.09
296 0.1
297 0.16
298 0.18
299 0.2
300 0.21
301 0.21
302 0.19
303 0.27
304 0.28
305 0.23
306 0.24
307 0.24
308 0.26
309 0.27
310 0.27
311 0.19
312 0.19
313 0.21
314 0.21
315 0.19
316 0.16
317 0.19
318 0.21
319 0.21
320 0.25
321 0.24
322 0.26
323 0.26
324 0.25
325 0.21
326 0.18
327 0.17
328 0.13
329 0.14
330 0.11
331 0.13
332 0.14
333 0.13
334 0.14
335 0.15
336 0.15
337 0.13
338 0.16
339 0.2
340 0.26
341 0.27
342 0.28
343 0.27
344 0.27
345 0.27
346 0.27
347 0.3
348 0.29
349 0.31
350 0.34
351 0.36
352 0.38
353 0.39
354 0.36
355 0.32
356 0.31
357 0.31
358 0.33
359 0.33
360 0.31
361 0.3
362 0.33
363 0.3
364 0.31
365 0.32
366 0.31
367 0.36
368 0.44
369 0.49
370 0.53
371 0.54