Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167DQ17

Protein Details
Accession A0A167DQ17    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
129-154LQVFLKSTKKLRNKRRQRLTAASTLDHydrophilic
NLS Segment(s)
PositionSequence
140-143RNKR
Subcellular Location(s) plas 15, E.R. 5, mito 3, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006153  Cation/H_exchanger  
IPR004712  Na+/H+_antiporter_fungi  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0015385  F:sodium:proton antiporter activity  
KEGG slb:AWJ20_1437  -  
Pfam View protein in Pfam  
PF00999  Na_H_Exchanger  
Amino Acid Sequences MVQPTVDLALNLGIFVWIGATMPWQDFVSTFALWKFIVMGIALLLFRRLPAVLLFYRIIPDIADLKEAVFTGFFGPIGVGALFYLEVALQEFQGMGLSNSNVMVRTIKPVVYFSILSSVLVHGISIPILQVFLKSTKKLRNKRRQRLTAASTLDTEDTVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.03
5 0.03
6 0.04
7 0.05
8 0.06
9 0.07
10 0.09
11 0.09
12 0.09
13 0.09
14 0.12
15 0.13
16 0.12
17 0.13
18 0.11
19 0.12
20 0.12
21 0.12
22 0.1
23 0.08
24 0.08
25 0.07
26 0.07
27 0.05
28 0.06
29 0.06
30 0.05
31 0.05
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.06
38 0.1
39 0.1
40 0.13
41 0.14
42 0.13
43 0.14
44 0.14
45 0.13
46 0.09
47 0.1
48 0.09
49 0.09
50 0.1
51 0.09
52 0.09
53 0.09
54 0.09
55 0.08
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.05
65 0.04
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.02
73 0.02
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.05
87 0.06
88 0.06
89 0.06
90 0.07
91 0.07
92 0.11
93 0.12
94 0.13
95 0.14
96 0.14
97 0.16
98 0.17
99 0.17
100 0.13
101 0.16
102 0.15
103 0.15
104 0.14
105 0.13
106 0.1
107 0.1
108 0.09
109 0.05
110 0.05
111 0.05
112 0.05
113 0.04
114 0.04
115 0.04
116 0.05
117 0.05
118 0.07
119 0.12
120 0.16
121 0.2
122 0.27
123 0.36
124 0.47
125 0.57
126 0.66
127 0.72
128 0.8
129 0.87
130 0.92
131 0.92
132 0.91
133 0.9
134 0.86
135 0.83
136 0.77
137 0.67
138 0.57
139 0.5
140 0.41