Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167ECP2

Protein Details
Accession A0A167ECP2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
97-133ASDGKISKEQRKKLKKERRKQEKKERASKPKADENDDBasic
NLS Segment(s)
PositionSequence
101-127KISKEQRKKLKKERRKQEKKERASKPK
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
KEGG slb:AWJ20_4862  -  
Amino Acid Sequences MATSTRYRRQAPTSSEIISSTTISNSEAEEVLTQYLDSITTKDSVSHQLTRLQRSLRGLPSLLQDPEEFVDGEDQADVNMDINMDADALPNGTVKPASDGKISKEQRKKLKKERRKQEKKERASKPKADENDDMSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.42
4 0.36
5 0.28
6 0.23
7 0.17
8 0.14
9 0.12
10 0.12
11 0.12
12 0.11
13 0.11
14 0.1
15 0.09
16 0.09
17 0.1
18 0.09
19 0.08
20 0.07
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.07
27 0.08
28 0.08
29 0.09
30 0.11
31 0.17
32 0.21
33 0.23
34 0.23
35 0.29
36 0.33
37 0.36
38 0.38
39 0.33
40 0.31
41 0.32
42 0.36
43 0.31
44 0.29
45 0.25
46 0.22
47 0.23
48 0.24
49 0.2
50 0.16
51 0.14
52 0.13
53 0.13
54 0.12
55 0.09
56 0.07
57 0.07
58 0.06
59 0.06
60 0.06
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.09
83 0.12
84 0.14
85 0.18
86 0.19
87 0.24
88 0.34
89 0.39
90 0.44
91 0.5
92 0.57
93 0.63
94 0.73
95 0.78
96 0.79
97 0.86
98 0.87
99 0.9
100 0.93
101 0.94
102 0.94
103 0.95
104 0.95
105 0.95
106 0.95
107 0.94
108 0.94
109 0.94
110 0.92
111 0.9
112 0.86
113 0.85
114 0.81
115 0.77
116 0.71