Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V1T8G7

Protein Details
Accession A0A1V1T8G7    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
37-66AMKNRRGEYEMKKRKKKKGWHFMTRRAVSSBasic
NLS Segment(s)
PositionSequence
39-55KNRRGEYEMKKRKKKKG
Subcellular Location(s) nucl 24.5, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MNGGIERDKNTRTESKEKENTKKKTDAQRLDVGSSGAMKNRRGEYEMKKRKKKKGWHFMTRRAVSSSSNDVCEAPAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.64
4 0.69
5 0.74
6 0.77
7 0.77
8 0.74
9 0.76
10 0.73
11 0.75
12 0.76
13 0.73
14 0.68
15 0.68
16 0.62
17 0.55
18 0.48
19 0.37
20 0.27
21 0.21
22 0.16
23 0.12
24 0.13
25 0.13
26 0.16
27 0.18
28 0.19
29 0.19
30 0.25
31 0.31
32 0.4
33 0.5
34 0.57
35 0.65
36 0.73
37 0.81
38 0.85
39 0.86
40 0.86
41 0.87
42 0.87
43 0.88
44 0.89
45 0.89
46 0.9
47 0.83
48 0.74
49 0.66
50 0.57
51 0.49
52 0.45
53 0.43
54 0.35
55 0.33
56 0.31
57 0.28