Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V1SY94

Protein Details
Accession A0A1V1SY94    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-40RETRHAFARPRRNRTPKTPKCHPDBasic
NLS Segment(s)
PositionSequence
25-34RPRRNRTPKT
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MQTEHGSDMRRWCCEDRETRHAFARPRRNRTPKTPKCHPDASKHGSNRSPLARRRDIAHNRRLSSEAEQHSSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.49
4 0.54
5 0.56
6 0.55
7 0.57
8 0.58
9 0.57
10 0.57
11 0.6
12 0.6
13 0.64
14 0.71
15 0.75
16 0.76
17 0.8
18 0.83
19 0.81
20 0.8
21 0.81
22 0.76
23 0.72
24 0.74
25 0.68
26 0.64
27 0.64
28 0.62
29 0.6
30 0.57
31 0.57
32 0.51
33 0.49
34 0.46
35 0.45
36 0.46
37 0.45
38 0.51
39 0.52
40 0.5
41 0.53
42 0.59
43 0.62
44 0.63
45 0.66
46 0.66
47 0.62
48 0.63
49 0.61
50 0.53
51 0.49
52 0.49
53 0.45