Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V1T670

Protein Details
Accession A0A1V1T670    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-42QLSTDPTQRRRQQNRIAQRKFREKKDQQHQAREAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MTTIDVDIQLSTDPTQRRRQQNRIAQRKFREKKDQQHQAREASGDDTTSNLKLSLGSGKSYYYPYALVKLLSTLGKGRVSVKNSAMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.34
3 0.42
4 0.53
5 0.61
6 0.69
7 0.74
8 0.79
9 0.85
10 0.86
11 0.87
12 0.84
13 0.83
14 0.85
15 0.82
16 0.8
17 0.8
18 0.77
19 0.78
20 0.8
21 0.82
22 0.78
23 0.8
24 0.76
25 0.68
26 0.6
27 0.5
28 0.4
29 0.31
30 0.24
31 0.14
32 0.11
33 0.09
34 0.09
35 0.08
36 0.08
37 0.07
38 0.07
39 0.06
40 0.07
41 0.12
42 0.12
43 0.12
44 0.13
45 0.13
46 0.15
47 0.17
48 0.16
49 0.12
50 0.13
51 0.13
52 0.16
53 0.16
54 0.15
55 0.13
56 0.13
57 0.15
58 0.13
59 0.14
60 0.13
61 0.16
62 0.17
63 0.19
64 0.23
65 0.28
66 0.31
67 0.35