Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4FCH5

Protein Details
Accession A0A0C4FCH5   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MSPKRQCRPPPTTRLIQCRHRPLRIKSKWQDSHQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MSPKRQCRPPPTTRLIQCRHRPLRIKSKWQDSHQLPHSYMGPKRRAIIPTSAPTRLTINLNPTINSGEVSAGITSINPIFTAQEDPGGTRTRPWRIPTGSSTSGNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.78
4 0.78
5 0.79
6 0.79
7 0.77
8 0.78
9 0.77
10 0.8
11 0.79
12 0.81
13 0.78
14 0.81
15 0.81
16 0.76
17 0.77
18 0.7
19 0.7
20 0.66
21 0.62
22 0.52
23 0.45
24 0.45
25 0.4
26 0.39
27 0.37
28 0.34
29 0.31
30 0.33
31 0.35
32 0.33
33 0.31
34 0.33
35 0.3
36 0.32
37 0.33
38 0.32
39 0.29
40 0.27
41 0.27
42 0.23
43 0.21
44 0.17
45 0.18
46 0.21
47 0.21
48 0.21
49 0.2
50 0.2
51 0.18
52 0.16
53 0.12
54 0.08
55 0.08
56 0.08
57 0.07
58 0.06
59 0.05
60 0.05
61 0.05
62 0.06
63 0.05
64 0.05
65 0.05
66 0.06
67 0.07
68 0.1
69 0.09
70 0.12
71 0.13
72 0.14
73 0.17
74 0.2
75 0.19
76 0.22
77 0.28
78 0.33
79 0.38
80 0.41
81 0.47
82 0.49
83 0.54
84 0.54
85 0.56
86 0.54