Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1T353

Protein Details
Accession A0A1V1T353   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-53RPITACHKNSKRKPPAQMRVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12.5, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MPAALAAQMDSHLTAARNTGLHPTGIGVFRTLRPITACHKNSKRKPPAQMRVSALLSVPWMRSANWREYDFGAGGSEDIVKAEQPLNTDDLQCSFLLVLVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.12
4 0.12
5 0.12
6 0.16
7 0.16
8 0.15
9 0.15
10 0.14
11 0.15
12 0.16
13 0.16
14 0.12
15 0.13
16 0.14
17 0.19
18 0.17
19 0.16
20 0.15
21 0.18
22 0.22
23 0.31
24 0.33
25 0.37
26 0.47
27 0.56
28 0.63
29 0.71
30 0.75
31 0.72
32 0.79
33 0.8
34 0.81
35 0.75
36 0.72
37 0.64
38 0.58
39 0.52
40 0.42
41 0.31
42 0.22
43 0.18
44 0.13
45 0.11
46 0.08
47 0.09
48 0.09
49 0.16
50 0.19
51 0.25
52 0.29
53 0.3
54 0.3
55 0.3
56 0.32
57 0.25
58 0.22
59 0.16
60 0.12
61 0.1
62 0.09
63 0.08
64 0.06
65 0.06
66 0.06
67 0.05
68 0.07
69 0.09
70 0.1
71 0.11
72 0.13
73 0.16
74 0.17
75 0.18
76 0.18
77 0.18
78 0.18
79 0.16
80 0.15
81 0.12