Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V1T943

Protein Details
Accession A0A1V1T943    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
66-87ASGIVPRSKKSRKVKKPTNTGRHydrophilic
NLS Segment(s)
PositionSequence
72-85RSKKSRKVKKPTNT
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MRRRGDDSEVREAPERRDSDIQERDSEQPSPTNQGSQSSKTARPPLTPSVFAQLQASVVLTDPGEASGIVPRSKKSRKVKKPTNTGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.4
3 0.36
4 0.39
5 0.4
6 0.43
7 0.49
8 0.47
9 0.42
10 0.43
11 0.41
12 0.38
13 0.36
14 0.28
15 0.24
16 0.23
17 0.25
18 0.23
19 0.22
20 0.2
21 0.24
22 0.26
23 0.25
24 0.29
25 0.28
26 0.3
27 0.31
28 0.37
29 0.33
30 0.32
31 0.33
32 0.35
33 0.34
34 0.33
35 0.3
36 0.29
37 0.28
38 0.26
39 0.22
40 0.16
41 0.13
42 0.11
43 0.11
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.09
55 0.12
56 0.14
57 0.15
58 0.18
59 0.27
60 0.34
61 0.44
62 0.51
63 0.6
64 0.69
65 0.79
66 0.87
67 0.88