Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V1SRF9

Protein Details
Accession A0A1V1SRF9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-40LWKTPWRLSRFQKARQRQRLRAVDAHydrophilic
77-103KYTMFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-96KEKRYRKGIHKLP
Subcellular Location(s) mito 23.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRATNALSSGLLWKTPWRLSRFQKARQRQRLRAVDAVVATVDQALAKKGETLKALDVWKETMPTEADMLPKDKYTMFDRKEKRYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.16
5 0.19
6 0.25
7 0.31
8 0.32
9 0.4
10 0.47
11 0.58
12 0.63
13 0.67
14 0.73
15 0.77
16 0.82
17 0.85
18 0.88
19 0.84
20 0.86
21 0.84
22 0.79
23 0.72
24 0.62
25 0.53
26 0.43
27 0.36
28 0.25
29 0.17
30 0.11
31 0.07
32 0.06
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.06
39 0.07
40 0.1
41 0.1
42 0.11
43 0.12
44 0.15
45 0.16
46 0.15
47 0.15
48 0.15
49 0.14
50 0.14
51 0.13
52 0.11
53 0.11
54 0.11
55 0.12
56 0.11
57 0.12
58 0.12
59 0.14
60 0.13
61 0.13
62 0.13
63 0.12
64 0.14
65 0.19
66 0.27
67 0.29
68 0.38
69 0.44
70 0.54
71 0.63
72 0.68
73 0.7
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79