Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4EYA6

Protein Details
Accession A0A0C4EYA6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MANNLAKKAPKKKVPEKKAEYKTPPHLWTHydrophilic
NLS Segment(s)
PositionSequence
7-18KKAPKKKVPEKK
Subcellular Location(s) nucl 14.5, mito_nucl 11.5, mito 7.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
Amino Acid Sequences MANNLAKKAPKKKVPEKKAEYKTPPHLWTYNQKEHLLELIAKYAGKRFATNNGGLIKLGWSHVMGNLNEHFDIELSRDQIKNHKAKLRNLYINFKFLCEQSGFGWDPEKTLEMADKEDVPDLNNTPVANITPVNQAKTTTASKPLAKRPAMALDPDDSDVKVNPAIAAPAAKRTCEGKNDAIKSGLGGLTNAIEKLAESKAKKTNGAQPAENLTCSKKAINLCSKMFLKTIAALEFLNFASILEKKDKAQTFLTLARSSSGSICEVWLQKEVSKMQSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.88
4 0.89
5 0.9
6 0.9
7 0.87
8 0.85
9 0.84
10 0.81
11 0.75
12 0.7
13 0.63
14 0.58
15 0.61
16 0.62
17 0.62
18 0.58
19 0.57
20 0.51
21 0.49
22 0.46
23 0.38
24 0.31
25 0.22
26 0.19
27 0.18
28 0.18
29 0.18
30 0.19
31 0.21
32 0.2
33 0.22
34 0.22
35 0.29
36 0.34
37 0.35
38 0.35
39 0.32
40 0.31
41 0.29
42 0.27
43 0.19
44 0.15
45 0.14
46 0.1
47 0.09
48 0.09
49 0.12
50 0.16
51 0.15
52 0.18
53 0.19
54 0.2
55 0.2
56 0.19
57 0.16
58 0.11
59 0.12
60 0.11
61 0.12
62 0.12
63 0.15
64 0.16
65 0.17
66 0.25
67 0.32
68 0.36
69 0.41
70 0.46
71 0.5
72 0.57
73 0.65
74 0.66
75 0.67
76 0.64
77 0.68
78 0.62
79 0.61
80 0.54
81 0.45
82 0.38
83 0.29
84 0.28
85 0.19
86 0.18
87 0.13
88 0.18
89 0.17
90 0.16
91 0.18
92 0.15
93 0.15
94 0.14
95 0.15
96 0.1
97 0.09
98 0.11
99 0.09
100 0.11
101 0.11
102 0.11
103 0.11
104 0.11
105 0.11
106 0.1
107 0.11
108 0.1
109 0.1
110 0.11
111 0.1
112 0.09
113 0.1
114 0.09
115 0.08
116 0.07
117 0.08
118 0.14
119 0.15
120 0.16
121 0.16
122 0.16
123 0.16
124 0.19
125 0.2
126 0.15
127 0.19
128 0.21
129 0.24
130 0.28
131 0.34
132 0.38
133 0.36
134 0.36
135 0.33
136 0.35
137 0.32
138 0.28
139 0.23
140 0.17
141 0.17
142 0.17
143 0.16
144 0.11
145 0.1
146 0.1
147 0.09
148 0.08
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.07
155 0.07
156 0.14
157 0.14
158 0.14
159 0.15
160 0.18
161 0.21
162 0.23
163 0.27
164 0.28
165 0.35
166 0.37
167 0.37
168 0.35
169 0.32
170 0.28
171 0.25
172 0.19
173 0.11
174 0.09
175 0.08
176 0.08
177 0.08
178 0.08
179 0.06
180 0.05
181 0.05
182 0.07
183 0.1
184 0.14
185 0.15
186 0.21
187 0.28
188 0.31
189 0.34
190 0.35
191 0.42
192 0.45
193 0.48
194 0.43
195 0.39
196 0.43
197 0.42
198 0.39
199 0.31
200 0.26
201 0.23
202 0.24
203 0.22
204 0.19
205 0.23
206 0.3
207 0.38
208 0.42
209 0.42
210 0.47
211 0.48
212 0.45
213 0.42
214 0.34
215 0.27
216 0.24
217 0.25
218 0.19
219 0.18
220 0.16
221 0.16
222 0.16
223 0.14
224 0.12
225 0.09
226 0.08
227 0.09
228 0.11
229 0.14
230 0.16
231 0.18
232 0.2
233 0.28
234 0.31
235 0.33
236 0.34
237 0.35
238 0.36
239 0.4
240 0.44
241 0.37
242 0.34
243 0.32
244 0.3
245 0.27
246 0.23
247 0.2
248 0.16
249 0.15
250 0.16
251 0.19
252 0.21
253 0.22
254 0.24
255 0.24
256 0.24
257 0.3
258 0.33