Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EY37

Protein Details
Accession A0A0C4EY37    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
113-133LKQPLNKKRKNVGKGNNDTEHHydrophilic
340-364GSAAQKKRVRPIKKLPKSKSTTPSAHydrophilic
NLS Segment(s)
PositionSequence
344-358QKKRVRPIKKLPKSK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLAQQRETDAAAEFHTWTAAQAIQVSKGCASGAGVPPTGHTKIFDDVSEKFRVGKHNKNISAIRHKLKDLIYIASGRKIRTSWPGEDTDHDLRRLKISLKIDHNKWSIVPEDLKQPLNKKRKNVGKGNNDTEHTAHNHDHPPQGKRPCVRDSSPAIDAPATDLRNGLADLTNCPSAPSNAPAPAATAPSDSPAPAAPSSGPAASDDPAALSDAPAPTAPSEAPAAPSDAPAPAAPFNDPAAPFNDPAAPSDAPAPAARSNDPAAPSDTPTAPTNVQNGCPAASTNRAAVNDPAAPCLAASTNRADVNDPAAPPETPAAPTNSQNGRPAASTNRAAAATNGSAAQKKRVRPIKKLPKSKSTTPSAPQATVDPAPYNNPAAPSINPAAPSINPAALSINPAAPSINPAAPSDATTPATAGDNVVPPLQLVGLEAAIDPLLETYSLSDLNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.11
5 0.12
6 0.11
7 0.11
8 0.14
9 0.15
10 0.19
11 0.21
12 0.22
13 0.2
14 0.2
15 0.19
16 0.15
17 0.15
18 0.17
19 0.21
20 0.23
21 0.24
22 0.24
23 0.26
24 0.31
25 0.31
26 0.25
27 0.21
28 0.2
29 0.23
30 0.25
31 0.24
32 0.23
33 0.24
34 0.28
35 0.29
36 0.27
37 0.25
38 0.27
39 0.36
40 0.4
41 0.46
42 0.52
43 0.6
44 0.63
45 0.68
46 0.7
47 0.69
48 0.71
49 0.7
50 0.67
51 0.61
52 0.58
53 0.57
54 0.53
55 0.51
56 0.43
57 0.38
58 0.32
59 0.33
60 0.33
61 0.34
62 0.35
63 0.29
64 0.29
65 0.26
66 0.28
67 0.32
68 0.37
69 0.35
70 0.37
71 0.4
72 0.4
73 0.42
74 0.45
75 0.44
76 0.41
77 0.4
78 0.38
79 0.35
80 0.36
81 0.36
82 0.32
83 0.3
84 0.34
85 0.39
86 0.46
87 0.53
88 0.53
89 0.59
90 0.58
91 0.52
92 0.46
93 0.41
94 0.32
95 0.28
96 0.27
97 0.21
98 0.26
99 0.28
100 0.31
101 0.32
102 0.38
103 0.44
104 0.52
105 0.55
106 0.56
107 0.62
108 0.69
109 0.75
110 0.77
111 0.77
112 0.78
113 0.82
114 0.81
115 0.76
116 0.67
117 0.6
118 0.51
119 0.44
120 0.35
121 0.3
122 0.24
123 0.24
124 0.27
125 0.28
126 0.33
127 0.35
128 0.38
129 0.42
130 0.48
131 0.49
132 0.5
133 0.53
134 0.53
135 0.54
136 0.51
137 0.5
138 0.49
139 0.47
140 0.44
141 0.39
142 0.34
143 0.28
144 0.25
145 0.22
146 0.21
147 0.16
148 0.14
149 0.13
150 0.13
151 0.13
152 0.13
153 0.11
154 0.08
155 0.08
156 0.1
157 0.12
158 0.13
159 0.12
160 0.13
161 0.12
162 0.12
163 0.13
164 0.14
165 0.14
166 0.14
167 0.15
168 0.14
169 0.15
170 0.14
171 0.14
172 0.12
173 0.11
174 0.09
175 0.1
176 0.1
177 0.09
178 0.08
179 0.08
180 0.1
181 0.08
182 0.09
183 0.08
184 0.09
185 0.1
186 0.1
187 0.09
188 0.08
189 0.1
190 0.09
191 0.09
192 0.07
193 0.06
194 0.07
195 0.07
196 0.06
197 0.05
198 0.06
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.07
205 0.07
206 0.06
207 0.07
208 0.07
209 0.08
210 0.08
211 0.1
212 0.09
213 0.1
214 0.09
215 0.08
216 0.09
217 0.07
218 0.08
219 0.07
220 0.08
221 0.08
222 0.09
223 0.09
224 0.11
225 0.11
226 0.11
227 0.12
228 0.13
229 0.13
230 0.13
231 0.14
232 0.12
233 0.13
234 0.16
235 0.14
236 0.12
237 0.14
238 0.13
239 0.12
240 0.12
241 0.14
242 0.12
243 0.14
244 0.14
245 0.15
246 0.16
247 0.17
248 0.18
249 0.16
250 0.17
251 0.16
252 0.18
253 0.18
254 0.17
255 0.17
256 0.16
257 0.18
258 0.16
259 0.17
260 0.2
261 0.19
262 0.2
263 0.19
264 0.19
265 0.17
266 0.16
267 0.14
268 0.12
269 0.14
270 0.14
271 0.14
272 0.16
273 0.17
274 0.17
275 0.17
276 0.18
277 0.18
278 0.17
279 0.17
280 0.14
281 0.13
282 0.11
283 0.12
284 0.1
285 0.08
286 0.1
287 0.11
288 0.15
289 0.16
290 0.17
291 0.17
292 0.17
293 0.2
294 0.2
295 0.18
296 0.16
297 0.17
298 0.16
299 0.15
300 0.16
301 0.13
302 0.12
303 0.13
304 0.16
305 0.17
306 0.19
307 0.25
308 0.28
309 0.3
310 0.32
311 0.32
312 0.29
313 0.27
314 0.28
315 0.26
316 0.27
317 0.27
318 0.24
319 0.25
320 0.24
321 0.24
322 0.22
323 0.2
324 0.15
325 0.13
326 0.14
327 0.13
328 0.16
329 0.17
330 0.26
331 0.28
332 0.32
333 0.41
334 0.49
335 0.55
336 0.61
337 0.71
338 0.74
339 0.79
340 0.85
341 0.83
342 0.84
343 0.84
344 0.83
345 0.8
346 0.77
347 0.74
348 0.67
349 0.69
350 0.62
351 0.56
352 0.47
353 0.41
354 0.38
355 0.32
356 0.3
357 0.22
358 0.19
359 0.22
360 0.23
361 0.23
362 0.2
363 0.2
364 0.2
365 0.21
366 0.21
367 0.23
368 0.24
369 0.24
370 0.23
371 0.22
372 0.22
373 0.2
374 0.23
375 0.19
376 0.17
377 0.16
378 0.15
379 0.17
380 0.15
381 0.18
382 0.16
383 0.16
384 0.15
385 0.15
386 0.15
387 0.13
388 0.16
389 0.17
390 0.17
391 0.17
392 0.17
393 0.2
394 0.2
395 0.23
396 0.22
397 0.22
398 0.22
399 0.21
400 0.2
401 0.17
402 0.19
403 0.16
404 0.15
405 0.14
406 0.15
407 0.16
408 0.17
409 0.15
410 0.13
411 0.14
412 0.12
413 0.1
414 0.08
415 0.08
416 0.07
417 0.07
418 0.07
419 0.07
420 0.07
421 0.07
422 0.06
423 0.05
424 0.05
425 0.05
426 0.05
427 0.06
428 0.09