Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1T281

Protein Details
Accession A0A1V1T281   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
120-160QTGFFAQRRRRRAKSNESGAIDRAARREKRRQELGVRLNTYHydrophilic
NLS Segment(s)
PositionSequence
127-150RRRRRAKSNESGAIDRAARREKRR
Subcellular Location(s) nucl 17, mito 5, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MNMLLTCGMAVHARELLTSVGAHIREQDVLHFWGLTCFWMQEFSYHGFDDDGILSTREGDVAFDKKGIISWLLDQQPDTGIAEPEYQPQPPQPPQPQSPQPPPQPQPQPQPQPQPLSLPQTGFFAQRRRRRAKSNESGAIDRAARREKRRQELGVRLNTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.11
5 0.1
6 0.1
7 0.12
8 0.12
9 0.13
10 0.13
11 0.14
12 0.14
13 0.15
14 0.15
15 0.14
16 0.16
17 0.16
18 0.14
19 0.13
20 0.13
21 0.13
22 0.12
23 0.09
24 0.08
25 0.08
26 0.1
27 0.1
28 0.09
29 0.12
30 0.15
31 0.17
32 0.16
33 0.16
34 0.14
35 0.14
36 0.14
37 0.12
38 0.1
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.07
45 0.07
46 0.06
47 0.08
48 0.09
49 0.1
50 0.1
51 0.1
52 0.09
53 0.1
54 0.1
55 0.08
56 0.07
57 0.08
58 0.13
59 0.14
60 0.14
61 0.14
62 0.14
63 0.13
64 0.13
65 0.12
66 0.07
67 0.06
68 0.07
69 0.08
70 0.08
71 0.11
72 0.11
73 0.11
74 0.11
75 0.13
76 0.17
77 0.19
78 0.26
79 0.3
80 0.34
81 0.37
82 0.44
83 0.5
84 0.51
85 0.57
86 0.57
87 0.58
88 0.61
89 0.61
90 0.62
91 0.64
92 0.63
93 0.63
94 0.65
95 0.66
96 0.64
97 0.71
98 0.67
99 0.64
100 0.59
101 0.56
102 0.5
103 0.48
104 0.44
105 0.36
106 0.31
107 0.29
108 0.28
109 0.26
110 0.27
111 0.29
112 0.37
113 0.44
114 0.53
115 0.59
116 0.65
117 0.71
118 0.78
119 0.79
120 0.81
121 0.82
122 0.81
123 0.77
124 0.72
125 0.63
126 0.57
127 0.48
128 0.39
129 0.36
130 0.36
131 0.39
132 0.44
133 0.53
134 0.6
135 0.67
136 0.74
137 0.76
138 0.77
139 0.8
140 0.82