Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1TPV0

Protein Details
Accession A0A1V1TPV0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
98-124PEEKSKTLEKTKKKATHFPQRKYAVKAHydrophilic
NLS Segment(s)
PositionSequence
85-114RPKQTRAIRRRLSPEEKSKTLEKTKKKATH
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTSKVKTGQLWNKSKDDLIKQLGELKTELGQLRIQKITSSGSKLNKIHDLRKSIARVLTVVNLKQRQQLRLFYKNKKYLPLDLRPKQTRAIRRRLSPEEKSKTLEKTKKKATHFPQRKYAVKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.58
3 0.54
4 0.5
5 0.48
6 0.44
7 0.4
8 0.37
9 0.43
10 0.4
11 0.35
12 0.3
13 0.24
14 0.2
15 0.22
16 0.21
17 0.15
18 0.18
19 0.19
20 0.22
21 0.23
22 0.21
23 0.18
24 0.19
25 0.21
26 0.21
27 0.23
28 0.24
29 0.26
30 0.33
31 0.34
32 0.36
33 0.4
34 0.41
35 0.43
36 0.43
37 0.44
38 0.39
39 0.44
40 0.43
41 0.37
42 0.35
43 0.29
44 0.24
45 0.2
46 0.21
47 0.17
48 0.17
49 0.19
50 0.2
51 0.2
52 0.25
53 0.27
54 0.27
55 0.28
56 0.35
57 0.37
58 0.45
59 0.52
60 0.55
61 0.62
62 0.66
63 0.65
64 0.63
65 0.59
66 0.58
67 0.58
68 0.59
69 0.6
70 0.58
71 0.66
72 0.63
73 0.62
74 0.61
75 0.61
76 0.61
77 0.59
78 0.64
79 0.61
80 0.64
81 0.71
82 0.73
83 0.74
84 0.73
85 0.75
86 0.72
87 0.69
88 0.66
89 0.62
90 0.6
91 0.62
92 0.63
93 0.62
94 0.63
95 0.71
96 0.75
97 0.78
98 0.8
99 0.8
100 0.82
101 0.83
102 0.81
103 0.81
104 0.82
105 0.81