Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1T3U5

Protein Details
Accession A0A1V1T3U5   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
68-89KMYKTRLAKWKMLKNRPRGSGHHydrophilic
NLS Segment(s)
PositionSequence
81-83KNR
Subcellular Location(s) cyto 10, cyto_nucl 9.5, nucl 7, mito 4, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MPSHAMSIDNLCNDYAQEDYSRHPNWATPEDWDAHQETIRRLYLDEKRPLKDVVVIMESEYGFRATAKMYKTRLAKWKMLKNRPRGSGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.1
4 0.11
5 0.11
6 0.14
7 0.21
8 0.22
9 0.22
10 0.22
11 0.23
12 0.26
13 0.29
14 0.27
15 0.22
16 0.24
17 0.24
18 0.24
19 0.23
20 0.2
21 0.17
22 0.18
23 0.17
24 0.16
25 0.18
26 0.18
27 0.16
28 0.15
29 0.2
30 0.26
31 0.31
32 0.38
33 0.38
34 0.39
35 0.41
36 0.41
37 0.35
38 0.31
39 0.25
40 0.19
41 0.17
42 0.15
43 0.13
44 0.14
45 0.14
46 0.1
47 0.1
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.12
54 0.15
55 0.21
56 0.23
57 0.29
58 0.34
59 0.41
60 0.49
61 0.51
62 0.57
63 0.59
64 0.67
65 0.72
66 0.78
67 0.79
68 0.8
69 0.83