Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FEC5

Protein Details
Accession A0A0C4FEC5    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
76-95APAKRPAPKAPRPRRSPPALHydrophilic
NLS Segment(s)
PositionSequence
78-93AKRPAPKAPRPRRSPP
Subcellular Location(s) nucl 16, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MACLLAIDPALYLRILRFEPIQLAVLEDKVRAVLDQEFEARFAQHLRQREDAGRAEGLSSAGSSDDDSGEDALDEAPAKRPAPKAPRPRRSPPALSKHVLHADTLARWLDLQAISYFLLDPAVPRKPRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.13
5 0.14
6 0.16
7 0.17
8 0.18
9 0.15
10 0.16
11 0.15
12 0.16
13 0.15
14 0.13
15 0.11
16 0.1
17 0.1
18 0.08
19 0.09
20 0.09
21 0.1
22 0.11
23 0.13
24 0.13
25 0.14
26 0.14
27 0.13
28 0.11
29 0.11
30 0.16
31 0.18
32 0.24
33 0.27
34 0.29
35 0.31
36 0.33
37 0.36
38 0.32
39 0.3
40 0.24
41 0.2
42 0.18
43 0.15
44 0.13
45 0.09
46 0.07
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.07
64 0.09
65 0.1
66 0.13
67 0.15
68 0.23
69 0.32
70 0.41
71 0.49
72 0.59
73 0.68
74 0.73
75 0.79
76 0.8
77 0.79
78 0.79
79 0.77
80 0.76
81 0.73
82 0.68
83 0.61
84 0.58
85 0.56
86 0.47
87 0.38
88 0.3
89 0.26
90 0.23
91 0.24
92 0.19
93 0.13
94 0.13
95 0.13
96 0.14
97 0.12
98 0.13
99 0.11
100 0.12
101 0.12
102 0.13
103 0.13
104 0.09
105 0.1
106 0.08
107 0.1
108 0.14
109 0.22