Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4FC51

Protein Details
Accession A0A0C4FC51    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25SRRHLPRAHRHPPRARRHLPQAGRHBasic
NLS Segment(s)
PositionSequence
4-20HLPRAHRHPPRARRHLP
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences SRRHLPRAHRHPPRARRHLPQAGRHPPQARCHLPQTCAIRHGLIAIRTGSPPSATLLLPSAPWPLSDYHIFYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.86
3 0.84
4 0.84
5 0.83
6 0.8
7 0.79
8 0.78
9 0.77
10 0.74
11 0.72
12 0.67
13 0.62
14 0.61
15 0.6
16 0.54
17 0.48
18 0.51
19 0.48
20 0.44
21 0.46
22 0.45
23 0.38
24 0.34
25 0.31
26 0.24
27 0.21
28 0.21
29 0.17
30 0.12
31 0.13
32 0.12
33 0.13
34 0.13
35 0.13
36 0.12
37 0.1
38 0.1
39 0.1
40 0.11
41 0.1
42 0.11
43 0.12
44 0.12
45 0.12
46 0.12
47 0.13
48 0.11
49 0.12
50 0.13
51 0.13
52 0.17
53 0.2