Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V1T558

Protein Details
Accession A0A1V1T558    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
93-119AKMAEKMHKKRVERLKRKEKRNKLINSBasic
NLS Segment(s)
PositionSequence
31-33PRK
47-115REKKRLAMAVTKAKEKEMKEEKEAERQQRIQKIKDRRAAKEEKERYAKMAEKMHKKRVERLKRKEKRNK
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSDETAIAGAGAKSQDVPQGMRKNGKQWHAPRKAFRPAAGLTSYEQREKKRLAMAVTKAKEKEMKEEKEAERQQRIQKIKDRRAAKEEKERYAKMAEKMHKKRVERLKRKEKRNKLINS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.13
4 0.16
5 0.23
6 0.31
7 0.35
8 0.42
9 0.43
10 0.48
11 0.52
12 0.55
13 0.56
14 0.58
15 0.65
16 0.68
17 0.72
18 0.72
19 0.72
20 0.76
21 0.69
22 0.6
23 0.54
24 0.45
25 0.42
26 0.36
27 0.3
28 0.21
29 0.25
30 0.25
31 0.25
32 0.27
33 0.25
34 0.29
35 0.3
36 0.32
37 0.3
38 0.31
39 0.3
40 0.33
41 0.36
42 0.4
43 0.4
44 0.4
45 0.36
46 0.34
47 0.35
48 0.3
49 0.33
50 0.33
51 0.35
52 0.35
53 0.42
54 0.42
55 0.48
56 0.53
57 0.49
58 0.46
59 0.48
60 0.51
61 0.52
62 0.55
63 0.51
64 0.55
65 0.6
66 0.63
67 0.65
68 0.66
69 0.63
70 0.66
71 0.68
72 0.67
73 0.68
74 0.66
75 0.66
76 0.67
77 0.63
78 0.57
79 0.55
80 0.53
81 0.48
82 0.51
83 0.51
84 0.54
85 0.62
86 0.69
87 0.7
88 0.68
89 0.72
90 0.74
91 0.77
92 0.77
93 0.8
94 0.82
95 0.84
96 0.92
97 0.94
98 0.94
99 0.93