Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V1TN71

Protein Details
Accession A0A1V1TN71    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-34EKSADQRRDAPRRVRKIQNPRTAKAHydrophilic
NLS Segment(s)
PositionSequence
16-52RRDAPRRVRKIQNPRTAKAPRRVMIPRPRQKARRRAP
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MGCHISKETEKSADQRRDAPRRVRKIQNPRTAKAPRRVMIPRPRQKARRRAPEPEHPVMSEGELDELHAIIERPLRLRPAPMDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.58
4 0.63
5 0.68
6 0.72
7 0.72
8 0.73
9 0.79
10 0.8
11 0.8
12 0.82
13 0.85
14 0.84
15 0.81
16 0.73
17 0.74
18 0.73
19 0.7
20 0.68
21 0.65
22 0.56
23 0.56
24 0.59
25 0.58
26 0.6
27 0.64
28 0.63
29 0.63
30 0.69
31 0.71
32 0.76
33 0.78
34 0.78
35 0.78
36 0.75
37 0.77
38 0.77
39 0.78
40 0.78
41 0.72
42 0.64
43 0.53
44 0.48
45 0.39
46 0.33
47 0.23
48 0.15
49 0.1
50 0.08
51 0.08
52 0.07
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.11
59 0.12
60 0.14
61 0.16
62 0.21
63 0.22
64 0.27