Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1SVL7

Protein Details
Accession A0A1V1SVL7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKKSSRKPQGPKKREGLAKEBasic
NLS Segment(s)
PositionSequence
3-18KRKKSSRKPQGPKKRE
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPQGPKKREGLAKEFTCLFCNHEKSVHVKLDKKAGVGQLSCAVCGQQFQCGIHTLVEAIDVYSEWVDAADAVAKEAANDKTTGSTSFTRPGVRAPITDREVDDEEDEHRYEGEGIVADDDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.87
3 0.85
4 0.8
5 0.75
6 0.71
7 0.69
8 0.62
9 0.56
10 0.51
11 0.43
12 0.39
13 0.33
14 0.3
15 0.28
16 0.3
17 0.28
18 0.28
19 0.28
20 0.31
21 0.37
22 0.4
23 0.37
24 0.39
25 0.4
26 0.47
27 0.46
28 0.42
29 0.38
30 0.34
31 0.33
32 0.27
33 0.26
34 0.23
35 0.22
36 0.2
37 0.17
38 0.14
39 0.11
40 0.13
41 0.12
42 0.09
43 0.1
44 0.1
45 0.11
46 0.13
47 0.14
48 0.12
49 0.12
50 0.09
51 0.07
52 0.07
53 0.06
54 0.04
55 0.03
56 0.03
57 0.04
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.1
72 0.11
73 0.09
74 0.1
75 0.1
76 0.11
77 0.13
78 0.13
79 0.14
80 0.15
81 0.17
82 0.21
83 0.23
84 0.23
85 0.23
86 0.24
87 0.27
88 0.26
89 0.27
90 0.27
91 0.33
92 0.33
93 0.35
94 0.32
95 0.31
96 0.32
97 0.31
98 0.27
99 0.21
100 0.2
101 0.21
102 0.21
103 0.16
104 0.14
105 0.13
106 0.13
107 0.12
108 0.12
109 0.1
110 0.09
111 0.1