Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1TL36

Protein Details
Accession A0A1V1TL36    Localization Confidence High Confidence Score 20.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-45RFLPNYKKRSLSKRLKPHKVSEKKAYTHydrophilic
77-123QEERMEKQKTKKEEKKRERERDFIAPDEPVDGEHKKKKRKTRVQNEEBasic
NLS Segment(s)
PositionSequence
25-41KKRSLSKRLKPHKVSEK
72-98KKRMAQEERMEKQKTKKEEKKRERERD
108-118GEHKKKKRKTR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR024166  rRNA_assembly_KRR1  
Amino Acid Sequences MVKRELAKDPLLKHESWDRFLPNYKKRSLSKRLKPHKVSEKKAYTPFPPAAEPSKVDLQLEAGEYHIGRDAKKRMAQEERMEKQKTKKEEKKRERERDFIAPDEPVDGEHKKKKRKTRVQNEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.43
4 0.44
5 0.38
6 0.38
7 0.47
8 0.52
9 0.51
10 0.53
11 0.54
12 0.58
13 0.62
14 0.67
15 0.69
16 0.7
17 0.72
18 0.77
19 0.83
20 0.86
21 0.85
22 0.85
23 0.85
24 0.84
25 0.81
26 0.8
27 0.77
28 0.72
29 0.73
30 0.66
31 0.57
32 0.53
33 0.48
34 0.4
35 0.33
36 0.3
37 0.27
38 0.25
39 0.24
40 0.22
41 0.22
42 0.21
43 0.19
44 0.17
45 0.14
46 0.13
47 0.13
48 0.09
49 0.06
50 0.06
51 0.06
52 0.07
53 0.09
54 0.09
55 0.08
56 0.14
57 0.17
58 0.21
59 0.25
60 0.27
61 0.3
62 0.36
63 0.41
64 0.44
65 0.51
66 0.51
67 0.55
68 0.56
69 0.54
70 0.55
71 0.57
72 0.57
73 0.59
74 0.64
75 0.68
76 0.76
77 0.84
78 0.87
79 0.91
80 0.93
81 0.89
82 0.86
83 0.81
84 0.79
85 0.72
86 0.64
87 0.55
88 0.44
89 0.38
90 0.32
91 0.26
92 0.17
93 0.17
94 0.18
95 0.23
96 0.32
97 0.4
98 0.49
99 0.58
100 0.67
101 0.74
102 0.82
103 0.86