Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1T9H4

Protein Details
Accession A0A1V1T9H4   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-43PSSSTNPPHKESRRRRNRRRHVKKTAEARLQVHydrophilic
NLS Segment(s)
PositionSequence
20-35HKESRRRRNRRRHVKK
Subcellular Location(s) nucl 12.5, cyto_nucl 11, mito 7, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MPPQATATSGEPSSSTNPPHKESRRRRNRRRHVKKTAEARLQVLTVPPHDVHAIPVANRLVAAIEAKIPYNTPTSGEGKASRVRFNRKERHEIYELRLAIRALIEIPESEFVAAFSAAPGGLPAPLDHRAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.29
4 0.33
5 0.37
6 0.47
7 0.54
8 0.6
9 0.68
10 0.74
11 0.78
12 0.85
13 0.92
14 0.93
15 0.95
16 0.96
17 0.96
18 0.96
19 0.95
20 0.95
21 0.92
22 0.91
23 0.9
24 0.86
25 0.76
26 0.67
27 0.57
28 0.47
29 0.38
30 0.3
31 0.21
32 0.14
33 0.15
34 0.13
35 0.12
36 0.13
37 0.12
38 0.11
39 0.13
40 0.13
41 0.11
42 0.14
43 0.13
44 0.12
45 0.11
46 0.1
47 0.07
48 0.07
49 0.07
50 0.04
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.07
57 0.09
58 0.09
59 0.1
60 0.13
61 0.15
62 0.16
63 0.18
64 0.18
65 0.19
66 0.24
67 0.25
68 0.28
69 0.31
70 0.39
71 0.46
72 0.55
73 0.61
74 0.63
75 0.7
76 0.67
77 0.69
78 0.65
79 0.6
80 0.55
81 0.53
82 0.47
83 0.38
84 0.37
85 0.29
86 0.24
87 0.2
88 0.16
89 0.09
90 0.09
91 0.08
92 0.07
93 0.08
94 0.09
95 0.09
96 0.09
97 0.08
98 0.08
99 0.08
100 0.08
101 0.07
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.05
108 0.05
109 0.06
110 0.06
111 0.1