Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1TG64

Protein Details
Accession A0A1V1TG64    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-88LPPIRRLRSPPPRYRRARRLPRPLANYRRBasic
NLS Segment(s)
PositionSequence
64-82RRLRSPPPRYRRARRLPRP
Subcellular Location(s) nucl 19, cyto 5, pero 2
Family & Domain DBs
Amino Acid Sequences MPEAVAAHNERIVAQMIAEMERDDSDDEPPLPGYNDDCRPPPYIVNDYNTWDDIDLCDGLPPIRRLRSPPPRYRRARRLPRPLANYRRIPVNSWPYILLRYYENFLEERIYKRVQAEYQVEFVAHRILTTRSVDEIKRSVYDPSLIDQYIDEAINFAEAVYPRLFVLFQLVPPHGRAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.11
5 0.12
6 0.1
7 0.09
8 0.09
9 0.11
10 0.1
11 0.1
12 0.11
13 0.13
14 0.13
15 0.13
16 0.14
17 0.14
18 0.13
19 0.13
20 0.15
21 0.18
22 0.22
23 0.23
24 0.25
25 0.27
26 0.29
27 0.3
28 0.3
29 0.3
30 0.33
31 0.34
32 0.35
33 0.34
34 0.34
35 0.35
36 0.32
37 0.26
38 0.2
39 0.17
40 0.13
41 0.13
42 0.1
43 0.08
44 0.07
45 0.07
46 0.08
47 0.12
48 0.13
49 0.15
50 0.18
51 0.19
52 0.24
53 0.34
54 0.44
55 0.51
56 0.59
57 0.64
58 0.71
59 0.79
60 0.84
61 0.84
62 0.84
63 0.85
64 0.85
65 0.87
66 0.87
67 0.85
68 0.84
69 0.82
70 0.8
71 0.75
72 0.69
73 0.58
74 0.55
75 0.48
76 0.42
77 0.39
78 0.38
79 0.32
80 0.3
81 0.3
82 0.24
83 0.25
84 0.22
85 0.17
86 0.11
87 0.11
88 0.12
89 0.11
90 0.11
91 0.11
92 0.1
93 0.12
94 0.12
95 0.14
96 0.17
97 0.18
98 0.18
99 0.19
100 0.22
101 0.21
102 0.25
103 0.26
104 0.24
105 0.25
106 0.24
107 0.22
108 0.19
109 0.18
110 0.14
111 0.1
112 0.08
113 0.08
114 0.09
115 0.12
116 0.14
117 0.15
118 0.15
119 0.19
120 0.2
121 0.22
122 0.23
123 0.22
124 0.22
125 0.22
126 0.21
127 0.2
128 0.22
129 0.19
130 0.19
131 0.21
132 0.19
133 0.18
134 0.17
135 0.17
136 0.15
137 0.14
138 0.11
139 0.08
140 0.08
141 0.08
142 0.08
143 0.06
144 0.08
145 0.08
146 0.11
147 0.11
148 0.12
149 0.12
150 0.13
151 0.13
152 0.1
153 0.16
154 0.14
155 0.16
156 0.2
157 0.22
158 0.23