Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1TFY3

Protein Details
Accession A0A1V1TFY3   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-51DPENPRCVGRCRRPRKKPEAEVRNGRNSQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MCKYVRYIRPKCGHKIGVRWEIDPENPRCVGRCRRPRKKPEAEVRNGRNSQLCEQDCTLTLDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.68
4 0.67
5 0.62
6 0.55
7 0.49
8 0.43
9 0.42
10 0.4
11 0.34
12 0.28
13 0.28
14 0.27
15 0.25
16 0.3
17 0.35
18 0.39
19 0.47
20 0.55
21 0.65
22 0.75
23 0.83
24 0.87
25 0.89
26 0.89
27 0.89
28 0.88
29 0.87
30 0.87
31 0.83
32 0.81
33 0.72
34 0.64
35 0.58
36 0.51
37 0.47
38 0.46
39 0.42
40 0.37
41 0.38
42 0.38
43 0.34