Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3B8C8

Protein Details
Accession G3B8C8   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-22SMNQRKFKKAIQNKSKLRIKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 13.5, mito 6.5
Family & Domain DBs
KEGG cten:CANTEDRAFT_115827  -  
Amino Acid Sequences MSMNQRKFKKAIQNKSKLRIKNDSSDLLMYLIYIDYLNRLIKQSQVNGTISVVKLKQENKTLSKQYRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.85
4 0.8
5 0.76
6 0.74
7 0.68
8 0.65
9 0.62
10 0.54
11 0.48
12 0.43
13 0.36
14 0.27
15 0.22
16 0.13
17 0.09
18 0.06
19 0.05
20 0.04
21 0.03
22 0.04
23 0.06
24 0.06
25 0.07
26 0.08
27 0.09
28 0.13
29 0.16
30 0.19
31 0.21
32 0.24
33 0.25
34 0.24
35 0.25
36 0.23
37 0.21
38 0.21
39 0.18
40 0.16
41 0.2
42 0.23
43 0.29
44 0.34
45 0.41
46 0.43
47 0.52
48 0.6