Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1TTS9

Protein Details
Accession A0A1V1TTS9    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
49-74ITADEKPQSRKTKKFNRHQSDRFSTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito_nucl 10.999, cyto_nucl 10.333, mito 9.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MLWRVHEPPPQTSVFAKFPHLPKTPTTPTNFFSICETRHPDGTTPTNPITADEKPQSRKTKKFNRHQSDRFSTSPKSNFLVSHTNPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.32
4 0.33
5 0.35
6 0.41
7 0.42
8 0.39
9 0.37
10 0.44
11 0.46
12 0.46
13 0.48
14 0.43
15 0.41
16 0.44
17 0.41
18 0.33
19 0.32
20 0.29
21 0.24
22 0.25
23 0.29
24 0.26
25 0.27
26 0.28
27 0.24
28 0.25
29 0.28
30 0.25
31 0.23
32 0.22
33 0.21
34 0.2
35 0.21
36 0.21
37 0.17
38 0.2
39 0.21
40 0.25
41 0.29
42 0.38
43 0.46
44 0.5
45 0.57
46 0.63
47 0.7
48 0.75
49 0.81
50 0.84
51 0.84
52 0.88
53 0.87
54 0.86
55 0.84
56 0.8
57 0.73
58 0.66
59 0.6
60 0.58
61 0.55
62 0.49
63 0.43
64 0.39
65 0.36
66 0.36
67 0.41