Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1TNH7

Protein Details
Accession A0A1V1TNH7   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
6-39FRIFSPEKSKEDRAKRRKAQLRKAQLTYRERKERBasic
NLS Segment(s)
PositionSequence
13-29KSKEDRAKRRKAQLRKA
Subcellular Location(s) mito 10, cyto 8.5, cyto_nucl 8, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MASNVFRIFSPEKSKEDRAKRRKAQLRKAQLTYRERKERYTKALEEHVAEARGNEADLCQEIHELRRTVQQLAGFIRHHGMKIPDEIPLPVGLDHVHEDSPASVWPPQQGYQQDYQQDYQPSVQLVNETAIQIHSTLREEGVNAPAIPGPTRPLRLGDLDPLAVGMEFVLALERPCVDHLYPHPDQAHEVGGHALTVSGQLAPAYPKSVFESYKPHETFCREVPEQSLHSLLALSSELCPESEITPIQAWNHIRSQPLFGGLEAPNLWRLAEKLRDAATCHGFGAVVKREFFEKLVFETLLVGRAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.61
3 0.7
4 0.75
5 0.76
6 0.81
7 0.85
8 0.88
9 0.9
10 0.91
11 0.91
12 0.9
13 0.91
14 0.89
15 0.87
16 0.83
17 0.83
18 0.82
19 0.81
20 0.8
21 0.79
22 0.72
23 0.74
24 0.76
25 0.74
26 0.73
27 0.72
28 0.67
29 0.62
30 0.67
31 0.61
32 0.54
33 0.48
34 0.42
35 0.34
36 0.3
37 0.24
38 0.18
39 0.16
40 0.13
41 0.1
42 0.08
43 0.07
44 0.08
45 0.09
46 0.08
47 0.09
48 0.1
49 0.14
50 0.19
51 0.19
52 0.2
53 0.26
54 0.27
55 0.27
56 0.29
57 0.27
58 0.25
59 0.27
60 0.3
61 0.24
62 0.23
63 0.24
64 0.22
65 0.21
66 0.2
67 0.2
68 0.18
69 0.22
70 0.21
71 0.21
72 0.21
73 0.21
74 0.18
75 0.16
76 0.14
77 0.1
78 0.1
79 0.07
80 0.08
81 0.09
82 0.1
83 0.09
84 0.09
85 0.09
86 0.09
87 0.09
88 0.08
89 0.08
90 0.08
91 0.09
92 0.12
93 0.14
94 0.15
95 0.19
96 0.22
97 0.24
98 0.27
99 0.29
100 0.31
101 0.31
102 0.3
103 0.29
104 0.28
105 0.25
106 0.22
107 0.19
108 0.16
109 0.14
110 0.13
111 0.1
112 0.09
113 0.09
114 0.09
115 0.08
116 0.07
117 0.07
118 0.07
119 0.07
120 0.06
121 0.06
122 0.07
123 0.07
124 0.08
125 0.08
126 0.08
127 0.09
128 0.1
129 0.1
130 0.09
131 0.09
132 0.09
133 0.09
134 0.09
135 0.08
136 0.09
137 0.1
138 0.12
139 0.12
140 0.13
141 0.14
142 0.16
143 0.17
144 0.16
145 0.15
146 0.14
147 0.13
148 0.11
149 0.1
150 0.07
151 0.06
152 0.03
153 0.02
154 0.02
155 0.02
156 0.02
157 0.03
158 0.03
159 0.03
160 0.03
161 0.04
162 0.05
163 0.07
164 0.07
165 0.1
166 0.12
167 0.2
168 0.2
169 0.24
170 0.24
171 0.22
172 0.23
173 0.21
174 0.21
175 0.13
176 0.13
177 0.1
178 0.09
179 0.09
180 0.08
181 0.06
182 0.04
183 0.04
184 0.04
185 0.03
186 0.04
187 0.04
188 0.04
189 0.06
190 0.06
191 0.08
192 0.08
193 0.09
194 0.14
195 0.17
196 0.18
197 0.19
198 0.27
199 0.29
200 0.39
201 0.38
202 0.36
203 0.37
204 0.4
205 0.41
206 0.37
207 0.41
208 0.32
209 0.32
210 0.34
211 0.35
212 0.32
213 0.29
214 0.26
215 0.18
216 0.17
217 0.16
218 0.12
219 0.09
220 0.08
221 0.07
222 0.06
223 0.07
224 0.07
225 0.07
226 0.08
227 0.08
228 0.09
229 0.11
230 0.1
231 0.12
232 0.13
233 0.14
234 0.14
235 0.19
236 0.21
237 0.22
238 0.27
239 0.27
240 0.3
241 0.3
242 0.33
243 0.28
244 0.3
245 0.27
246 0.22
247 0.24
248 0.21
249 0.22
250 0.19
251 0.19
252 0.17
253 0.16
254 0.16
255 0.12
256 0.13
257 0.17
258 0.23
259 0.24
260 0.26
261 0.29
262 0.31
263 0.33
264 0.38
265 0.36
266 0.31
267 0.29
268 0.25
269 0.22
270 0.21
271 0.25
272 0.27
273 0.26
274 0.26
275 0.26
276 0.28
277 0.3
278 0.31
279 0.27
280 0.21
281 0.22
282 0.26
283 0.25
284 0.23
285 0.24
286 0.23