Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C4EME9

Protein Details
Accession A0A0C4EME9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-84ATPPPNPRPRHRRPPSSPRRRPIILBasic
NLS Segment(s)
PositionSequence
65-80NPRPRHRRPPSSPRRR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MGPPAAGPAVELKDGNINVALANNSLGLTTASHTSQTSPQAANTTRTQLPPNQVTPLNNATPPPNPRPRHRRPPSSPRRRPIILILLPDLPPELRDIQLDAAMTRDDDDDSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.15
4 0.13
5 0.12
6 0.13
7 0.13
8 0.08
9 0.08
10 0.08
11 0.07
12 0.07
13 0.07
14 0.06
15 0.06
16 0.07
17 0.08
18 0.08
19 0.09
20 0.1
21 0.11
22 0.14
23 0.17
24 0.18
25 0.17
26 0.18
27 0.21
28 0.23
29 0.25
30 0.23
31 0.24
32 0.23
33 0.24
34 0.26
35 0.24
36 0.28
37 0.28
38 0.27
39 0.26
40 0.25
41 0.25
42 0.26
43 0.26
44 0.22
45 0.19
46 0.18
47 0.17
48 0.2
49 0.24
50 0.27
51 0.34
52 0.37
53 0.45
54 0.55
55 0.62
56 0.69
57 0.74
58 0.78
59 0.77
60 0.85
61 0.87
62 0.89
63 0.89
64 0.84
65 0.83
66 0.74
67 0.67
68 0.62
69 0.6
70 0.52
71 0.45
72 0.41
73 0.35
74 0.33
75 0.31
76 0.25
77 0.16
78 0.12
79 0.13
80 0.13
81 0.11
82 0.12
83 0.14
84 0.14
85 0.16
86 0.16
87 0.13
88 0.13
89 0.12
90 0.12
91 0.11
92 0.11