Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1T3V4

Protein Details
Accession A0A1V1T3V4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
22-51APPPKRFHKDLSRKKRVRVRRLKASNIEKSBasic
NLS Segment(s)
PositionSequence
8-44VRGKRRTRGEELLVAPPPKRFHKDLSRKKRVRVRRLK
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
Amino Acid Sequences MELTPIRVRGKRRTRGEELLVAPPPKRFHKDLSRKKRVRVRRLKASNIEKSIPLEVLERIFWLSENVNFPRASPRLGRLLSGSSTLRETFLSAFGPTWEVWFGCVHGQNADFPVVRSYAGWEEDVERFGGNPRFQVGPLRPWLSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.76
4 0.73
5 0.66
6 0.61
7 0.56
8 0.49
9 0.42
10 0.39
11 0.38
12 0.37
13 0.39
14 0.37
15 0.4
16 0.49
17 0.6
18 0.67
19 0.74
20 0.79
21 0.78
22 0.84
23 0.85
24 0.84
25 0.84
26 0.84
27 0.82
28 0.82
29 0.85
30 0.84
31 0.84
32 0.82
33 0.79
34 0.71
35 0.63
36 0.53
37 0.47
38 0.4
39 0.3
40 0.22
41 0.16
42 0.12
43 0.12
44 0.11
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.08
52 0.12
53 0.13
54 0.15
55 0.15
56 0.15
57 0.2
58 0.2
59 0.2
60 0.17
61 0.19
62 0.22
63 0.23
64 0.23
65 0.18
66 0.19
67 0.18
68 0.19
69 0.17
70 0.12
71 0.13
72 0.13
73 0.12
74 0.11
75 0.11
76 0.09
77 0.1
78 0.1
79 0.09
80 0.09
81 0.08
82 0.1
83 0.09
84 0.09
85 0.09
86 0.08
87 0.09
88 0.09
89 0.09
90 0.1
91 0.13
92 0.13
93 0.14
94 0.14
95 0.14
96 0.15
97 0.17
98 0.15
99 0.13
100 0.14
101 0.13
102 0.12
103 0.12
104 0.14
105 0.14
106 0.15
107 0.15
108 0.14
109 0.17
110 0.18
111 0.19
112 0.16
113 0.13
114 0.12
115 0.17
116 0.23
117 0.21
118 0.21
119 0.23
120 0.24
121 0.25
122 0.33
123 0.31
124 0.32
125 0.39