Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3B3Q3

Protein Details
Accession G3B3Q3   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
36-64AKFDEKKDYFKRCNKKCEKKCPSSVSFCLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, mito_nucl 13.666, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
KEGG cten:CANTEDRAFT_114276  -  
Amino Acid Sequences MSLIKLNKKKSSLSTSSASSNSSGECYYAPHTNSFAKFDEKKDYFKRCNKKCEKKCPSSVSFCLSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.46
4 0.42
5 0.35
6 0.27
7 0.22
8 0.18
9 0.16
10 0.13
11 0.1
12 0.09
13 0.1
14 0.12
15 0.15
16 0.15
17 0.15
18 0.17
19 0.19
20 0.2
21 0.21
22 0.2
23 0.22
24 0.23
25 0.25
26 0.32
27 0.31
28 0.38
29 0.43
30 0.5
31 0.54
32 0.61
33 0.69
34 0.68
35 0.77
36 0.81
37 0.85
38 0.87
39 0.89
40 0.9
41 0.89
42 0.91
43 0.89
44 0.85
45 0.82
46 0.76