Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1TEX3

Protein Details
Accession A0A1V1TEX3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
105-126EPKTSRCTPRTQPWGRRRWPLAHydrophilic
NLS Segment(s)
PositionSequence
92-102KVPSRERARLR
Subcellular Location(s) mito 18.5, mito_nucl 12.333, nucl 5, cyto_nucl 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR020058  Glu/Gln-tRNA-synth_Ib_cat-dom  
IPR020061  Glu_tRNA_lig_a-bdl  
Gene Ontology GO:0004812  F:aminoacyl-tRNA ligase activity  
GO:0005524  F:ATP binding  
GO:0006412  P:translation  
GO:0043039  P:tRNA aminoacylation  
Pfam View protein in Pfam  
PF00749  tRNA-synt_1c  
Amino Acid Sequences MNFTRTFLSKRKLAKLVDNGKAWGWDDLRMPTIRGVGRRGITTPALRDFILKQGPSRNVVTMDWTSYWAANKNEIDPVAPQHTAISKKDRVKVPSRERARLRSSEPKTSRCTPRTQPWGRRRWPLARRYYYSTRPTLRASRTARQLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.67
4 0.67
5 0.62
6 0.55
7 0.48
8 0.46
9 0.38
10 0.32
11 0.24
12 0.19
13 0.19
14 0.2
15 0.23
16 0.22
17 0.22
18 0.18
19 0.22
20 0.22
21 0.23
22 0.24
23 0.25
24 0.26
25 0.26
26 0.26
27 0.24
28 0.25
29 0.25
30 0.25
31 0.23
32 0.23
33 0.22
34 0.22
35 0.2
36 0.22
37 0.24
38 0.22
39 0.21
40 0.25
41 0.27
42 0.29
43 0.29
44 0.25
45 0.22
46 0.22
47 0.24
48 0.18
49 0.17
50 0.14
51 0.15
52 0.14
53 0.13
54 0.13
55 0.14
56 0.14
57 0.16
58 0.16
59 0.16
60 0.16
61 0.16
62 0.16
63 0.12
64 0.14
65 0.12
66 0.12
67 0.11
68 0.11
69 0.14
70 0.16
71 0.18
72 0.22
73 0.26
74 0.31
75 0.37
76 0.42
77 0.44
78 0.5
79 0.58
80 0.61
81 0.65
82 0.66
83 0.68
84 0.68
85 0.7
86 0.67
87 0.61
88 0.59
89 0.59
90 0.58
91 0.6
92 0.61
93 0.59
94 0.6
95 0.63
96 0.66
97 0.59
98 0.62
99 0.59
100 0.64
101 0.69
102 0.73
103 0.75
104 0.75
105 0.82
106 0.81
107 0.82
108 0.79
109 0.79
110 0.78
111 0.77
112 0.78
113 0.76
114 0.76
115 0.75
116 0.76
117 0.74
118 0.72
119 0.71
120 0.65
121 0.6
122 0.61
123 0.61
124 0.59
125 0.6
126 0.6
127 0.6