Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1T6P3

Protein Details
Accession A0A1V1T6P3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
55-77EDVGRKFKKVKFKKGSRLRTVVRBasic
NLS Segment(s)
PositionSequence
59-79RKFKKVKFKKGSRLRTVVRDK
87-89RRR
Subcellular Location(s) mito 16, mito_nucl 12.833, cyto_mito 9.833, nucl 8.5
Family & Domain DBs
Amino Acid Sequences MLDNSLSMILRQALLKSTLKCLAKITNILTPPGISLRFLNYDKDGNGDFDGLFMEDVGRKFKKVKFKKGSRLRTVVRDKIVEPISQRRRAARSKSLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.21
3 0.21
4 0.24
5 0.3
6 0.3
7 0.3
8 0.31
9 0.31
10 0.3
11 0.32
12 0.31
13 0.29
14 0.29
15 0.29
16 0.26
17 0.21
18 0.19
19 0.17
20 0.15
21 0.1
22 0.1
23 0.11
24 0.16
25 0.16
26 0.17
27 0.17
28 0.18
29 0.17
30 0.19
31 0.17
32 0.13
33 0.13
34 0.11
35 0.09
36 0.08
37 0.08
38 0.06
39 0.05
40 0.04
41 0.04
42 0.05
43 0.06
44 0.11
45 0.11
46 0.12
47 0.17
48 0.21
49 0.32
50 0.39
51 0.5
52 0.56
53 0.66
54 0.76
55 0.82
56 0.88
57 0.86
58 0.85
59 0.78
60 0.78
61 0.76
62 0.72
63 0.66
64 0.58
65 0.51
66 0.5
67 0.48
68 0.4
69 0.36
70 0.4
71 0.45
72 0.5
73 0.52
74 0.51
75 0.57
76 0.63
77 0.67