Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V1STT7

Protein Details
Accession A0A1V1STT7    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-116AENPSSQTGAKKKKKKKRCPKSRRKISGFEEYYHydrophilic
NLS Segment(s)
PositionSequence
93-108AKKKKKKKRCPKSRRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018606  Arb1  
Gene Ontology GO:0033167  C:ARC complex  
GO:0031047  P:RNA-mediated gene silencing  
Pfam View protein in Pfam  
PF09692  Arb1  
Amino Acid Sequences MAELPADTSNRHSEGPMTTKFEVTPPQGTDITPISQQDDSPGLQAICGAGGVTNGAKSETDKSTGKDVSTCESDGVDDATIGAAENPSSQTGAKKKKKKKRCPKSRRKISGFEEYYADAPMTPIEALENKKRYDSARPFSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.31
3 0.32
4 0.33
5 0.32
6 0.32
7 0.32
8 0.32
9 0.32
10 0.3
11 0.3
12 0.26
13 0.29
14 0.28
15 0.28
16 0.28
17 0.25
18 0.23
19 0.19
20 0.18
21 0.17
22 0.17
23 0.17
24 0.16
25 0.16
26 0.14
27 0.13
28 0.15
29 0.11
30 0.11
31 0.11
32 0.08
33 0.06
34 0.06
35 0.05
36 0.03
37 0.03
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.05
44 0.06
45 0.1
46 0.1
47 0.14
48 0.15
49 0.17
50 0.21
51 0.22
52 0.21
53 0.19
54 0.19
55 0.18
56 0.18
57 0.17
58 0.13
59 0.12
60 0.12
61 0.1
62 0.1
63 0.07
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.05
75 0.06
76 0.06
77 0.11
78 0.19
79 0.3
80 0.39
81 0.49
82 0.59
83 0.69
84 0.8
85 0.87
86 0.9
87 0.91
88 0.93
89 0.95
90 0.96
91 0.97
92 0.97
93 0.96
94 0.92
95 0.9
96 0.84
97 0.84
98 0.75
99 0.65
100 0.56
101 0.47
102 0.4
103 0.31
104 0.25
105 0.14
106 0.11
107 0.1
108 0.09
109 0.07
110 0.06
111 0.08
112 0.12
113 0.17
114 0.26
115 0.31
116 0.31
117 0.33
118 0.36
119 0.38
120 0.45
121 0.5